arcfu-AF1763

Archaeoglobus fulgidus AF1763 gene, putative lipase or thermostable carboxylesterase

Comment

"consists of an N-terminal alpha\/beta-hydrolase fold domain a small lid domain and a C-terminal beta-barrel domain"

Relationship

Family : 6_AlphaBeta_hydrolase

Block : X

Position in NCBI Life Tree : Archaeoglobus fulgidus

Molecular evidence

No mutation

No kinetic

No disease

No substrate

Database

Sequence

Peptide

MRGLAVLVLLVFAVQVAAAEDFRPVVFVHGLAGSAGQFES
QGMRFAANGY PAEYVKTFEYDTISWALVVETDMLFSGLG
SEFGLNISQIIDPETLDKILS KSRERLIDETFSRLDRVI
DEALAESGADKVDLVGHSMGTFFLVRYVNSSP ERAAKVA
HLILLDGVWGVDAPEGIPTLAVFGNPKALPALGLPEEKVV
YNA TNVYFNNMTHVQLCTSPETFAVMFEFINGYKPATTD
IVPQDGDYVKVKGK FLAFATNGDVSGWLSIYPIDENGKR
LTRLPVKFMRVKGDFEVRLRKGQLY EFQFRKDFSPIIYH
YYRAPFVRDDLWARFLVSKPPLDVELLILPERLSPA AKE
TSGLLLIRYKEMIGEYDEEIGGVDEVYVNGVNVCTERICP
IERAVNG LWVFDRGADGKSDLDREVVRYSIMPFMSAADL
VVPAEGTISIAVKSRTGG EESFTIPAWSADRHSIIVQFS
DYI

References

Title : Structure of the alkalohyperthermophilic Archaeoglobus fulgidus lipase contains a unique C-terminal domain essential for long-chain substrate binding - Chen_2009_J.Mol.Biol_390_672
Author(s) : Chen CK , Lee GC , Ko TP , Guo RT , Huang LM , Liu HJ , Ho YF , Shaw JF , Wang AH
Ref : Journal of Molecular Biology , 390 :672 , 2009
Abstract : Chen_2009_J.Mol.Biol_390_672
ESTHER : Chen_2009_J.Mol.Biol_390_672
PubMedSearch : Chen_2009_J.Mol.Biol_390_672
PubMedID: 19447113
Gene_locus related to this paper: arcfu-AF1763

Title : Homology modeling and identification of serine 160 as nucleophile of the active site in a thermostable carboxylesterase from the archaeon Archaeoglobus fulgidus - Manco_2000_Protein.Eng_13_197
Author(s) : Manco G , Camardella L , Febbraio F , Adamo G , Carratore V , Rossi M
Ref : Protein Engineering , 13 :197 , 2000
Abstract : Manco_2000_Protein.Eng_13_197
ESTHER : Manco_2000_Protein.Eng_13_197
PubMedSearch : Manco_2000_Protein.Eng_13_197
PubMedID: 10775661
Gene_locus related to this paper: arcfu-AF1763