leima-q4qae7

Leishmania major lysophospholipase, putative

Comment

Relationship

Family : LYsophospholipase_carboxylesterase

Block : X

Position in NCBI Life Tree : Leishmania major

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTVPIDQLTNAQIKEELRTLYAVTDFADCIEHGDLQKKLQ
AIRNSTPITH GLRYGTLLEIGNKNPTGVVTLVHGLGDSA
YGWESVGHELLRRLPHLLFLL PTAPSRSVTINGGMPMPA
WYDIMDMCNSGLLRGRQDAASVRQSCDYVRSI AHVATKK
YGIPPQRVVYSGFSQGAAISLCTGLTAHIAPAGIACMSGY
LAA CTDVLPRIVQKAVPITMFHGRQDPVVPISAAKETKE
ILEKDGGVAPISFL EYDMDHSTLPQEIDDITSFLSRVLP
EKF

References

Title : The genome of the kinetoplastid parasite, Leishmania major - Ivens_2005_Science_309_436
Author(s) : Ivens AC , Peacock CS , Worthey EA , Murphy L , Aggarwal G , Berriman M , Sisk E , Rajandream MA , Adlem E , Aert R , Anupama A , Apostolou Z , Attipoe P , Bason N , Bauser C , Beck A , Beverley SM , Bianchettin G , Borzym K , Bothe G , Bruschi CV , Collins M , Cadag E , Ciarloni L , Clayton C , Coulson RM , Cronin A , Cruz AK , Davies RM , De Gaudenzi J , Dobson DE , Duesterhoeft A , Fazelina G , Fosker N , Frasch AC , Fraser A , Fuchs M , Gabel C , Goble A , Goffeau A , Harris D , Hertz-Fowler C , Hilbert H , Horn D , Huang Y , Klages S , Knights A , Kube M , Larke N , Litvin L , Lord A , Louie T , Marra M , Masuy D , Matthews K , Michaeli S , Mottram JC , Muller-Auer S , Munden H , Nelson S , Norbertczak H , Oliver K , O'Neil S , Pentony M , Pohl TM , Price C , Purnelle B , Quail MA , Rabbinowitsch E , Reinhardt R , Rieger M , Rinta J , Robben J , Robertson L , Ruiz JC , Rutter S , Saunders D , Schafer M , Schein J , Schwartz DC , Seeger K , Seyler A , Sharp S , Shin H , Sivam D , Squares R , Squares S , Tosato V , Vogt C , Volckaert G , Wambutt R , Warren T , Wedler H , Woodward J , Zhou S , Zimmermann W , Smith DF , Blackwell JM , Stuart KD , Barrell B , Myler PJ
Ref : Science , 309 :436 , 2005
Abstract : Ivens_2005_Science_309_436
ESTHER : Ivens_2005_Science_309_436
PubMedSearch : Ivens_2005_Science_309_436
PubMedID: 16020728
Gene_locus related to this paper: leima-e9ady6 , leima-L2464.12 , leima-L2802.02 , leima-OPB , leima-q4fw33 , leima-q4fwg8 , leima-q4fwj0 , leima-q4fya7 , leima-q4q0a1 , leima-q4q0t5 , leima-q4q0v0 , leima-q4q1h9 , leima-q4q2c9 , leima-q4q4j7 , leima-q4q4t6 , leima-q4q5j1 , leima-q4q6e9 , leima-q4q7v8 , leima-q4q8a8 , leima-q4q9g9 , leima-q4q080 , leima-q4q398 , leima-q4q615 , leima-q4q819 , leima-q4q871 , leima-q4q942 , leima-q4qae7 , leima-q4qb85 , leima-q4qdz7 , leima-q4qe26 , leima-q4qe31 , leima-q4qe85 , leima-q4qe86 , leima-q4qe87 , leima-q4qe90 , leima-q4qec8 , leima-q4qgz4 , leima-q4qgz5 , leima-q4qhs0 , leima-q4qj45