lodel-a5e0z5

Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus) Putative uncharacterized protein

Comment

Relationship

Family : DPP4N_Peptidase_S9

Block : X

Position in NCBI Life Tree : Lodderomyces elongisporus

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MFPTSKRNSPYGDGEVYELVEQNPSFLTKQSNSSHHKDEG
EQEQNENENE GEGKEGTSLRRSDESQFSAFFEDIEQCSM
GSNPGDDGSGGNNKRDFHDDP IFHAILRRYHKEGISVKI
CSGILIFCVIIWIGAVILYSQLQPLQLIDKVK WQTSIQI
SGQNITLNRYDPAFNNITFENWRRGEYKSPMQPVVWLAES
QYP KDNNGGGFYLTTRSKEQIVINQINSGYEKVFIENRK
FAYQNNFFYIEDLV PNPAKAIDELNSVHLVKTNGLSQWR
HLSFALYWLYNPMLASFQPIQPPSD SNGEKRNLPDLESL
VKLHFAEFSPDGKYIVFGFEHNLYIQELETDNVFQI THD
GSPAIFNGKPDWVYEEEVVATDRMIWWSPDSQNLAFAKLN
DSLVHDV DINYYVKPNNQVGMLYQQPDDDQQLARESNQY
PLHTAIKYPKPGTNNPLV TIHVCNIDSKNIIQIGDDETN
DETIGHDYILYQGAWIDKDSFLMKQTDRT SSLVLKRLFQ
LSSSTSTIVHAENITTAYGGWTERMKPFTVVKNGLEEANK
YIDTVVVDGKNYLAMYDLPSSTSPLKVFDKYQAIGEAFY
DKQENYIYFLT NNKSPMDSHLIGVGLKLGNYLEITDVKL
DGYYSTQFAPNGRLVNLLYEGP GEPWQKLLSMAEIHDQI
GEGEDSNDNGGNGGSGSSVKTTTEAAIKEVIDH QPLLNK
VKEFSEKIETLNLPTVVYKEIKLKKEDIKISVKEIFPPNF
NPKN GRKYPVVVHAYGGPGSQVLFKKFDIDFLQILSANL
DSIVLLVEPRGTGGR NWEFEAFASRKIGYWEPRDIQTFT
SEYLAVNKEFVDPQHVAIWGWSYGGF TTLKTLEYDAGSI
FKYGIAIAPVTNWLFYDSIYTERIMKHPLENPNYKET SR
INDVEKIAKAKRFLLMHGSSDDNVHIQNSMWLLDKLQTAN
VTNYDFEI FPDSNHNINYRNAGNMVYGKILRWLKDAFNG
KLDDLN

References

Title : Evolution of pathogenicity and sexual reproduction in eight Candida genomes - Butler_2009_Nature_459_657
Author(s) : Butler G , Rasmussen MD , Lin MF , Santos MA , Sakthikumar S , Munro CA , Rheinbay E , Grabherr M , Forche A , Reedy JL , Agrafioti I , Arnaud MB , Bates S , Brown AJ , Brunke S , Costanzo MC , Fitzpatrick DA , de Groot PW , Harris D , Hoyer LL , Hube B , Klis FM , Kodira C , Lennard N , Logue ME , Martin R , Neiman AM , Nikolaou E , Quail MA , Quinn J , Santos MC , Schmitzberger FF , Sherlock G , Shah P , Silverstein KA , Skrzypek MS , Soll D , Staggs R , Stansfield I , Stumpf MP , Sudbery PE , Srikantha T , Zeng Q , Berman J , Berriman M , Heitman J , Gow NA , Lorenz MC , Birren BW , Kellis M , Cuomo CA
Ref : Nature , 459 :657 , 2009
Abstract : Butler_2009_Nature_459_657
ESTHER : Butler_2009_Nature_459_657
PubMedSearch : Butler_2009_Nature_459_657
PubMedID: 19465905
Gene_locus related to this paper: canal-ATG15 , canal-bna7 , canal-c4yl13 , canal-LIP1 , canal-LIP2 , canal-LIP3 , canal-LIP4 , canal-LIP5 , canal-LIP6 , canal-LIP7 , canal-LIP8 , canal-LIP9 , canal-LIP10 , canal-ppme1 , canal-q5a0c9 , canal-q5a2i9 , canal-q5a042 , canal-q5ad17 , canal-q5aeu3 , canal-q5afp8 , canal-q5ag57 , canal-q5ai09 , canal-q5ai12 , canal-q5ajt3 , canal-q5akz5 , canal-q5apu4 , canal-q59l46 , canal-q59m48 , canal-q59nw6 , canal-q59u61 , canal-q59u64 , canal-q59vp0 , canal-q59y97 , canaw-c4ykb1 , canaw-c4yrn6 , canaw-c4yrn9 , canaw-c4yrr3 , canaw-c4yrv3 , canaw-c4ys26 , cantt-c5m3d7 , cantt-c5m3y5 , cantt-c5m4x0 , cantt-c5m5e8 , cantt-c5m5w2 , cantt-c5m8s7 , cantt-c5m9c2 , cantt-c5m465 , cantt-c5m751 , cantt-c5m793 , cantt-c5m893 , cantt-c5ma78 , cantt-c5mag0 , cantt-c5mbb8 , cantt-c5mc53 , cantt-c5md87 , cantt-c5mdy3 , cantt-c5mey7 , cantt-c5mfg0 , cantt-c5mfh8 , cantt-c5mg56 , cantt-c5mgj0 , cantt-c5mh75 , cantt-c5mh80 , cantt-c5mh89 , cantt-c5mhh0 , cantt-c5mhn5 , cantt-c5mij5 , cantt-c5min7 , clal4-c4xvt8 , clal4-c4xwy4 , clal4-c4xy03 , clal4-c4xyx9 , clal4-c4xzz1 , clal4-c4y3e1 , clal4-c4y4f2 , clal4-c4y4w8 , clal4-c4y5j4 , clal4-c4y5j9 , clal4-c4y7z7 , clal4-c4y8q1 , clal4-c4y035 , clal4-c4y481 , clal4-c4y538 , clal4-c4y898 , clal4-c4yas2 , clal4-c4yba6 , clal4-c4yba7 , clal4-c4yc85 , lodel-a5drz3 , lodel-a5ds97 , lodel-a5dsc0 , lodel-a5duu4 , lodel-a5duy7 , lodel-a5dv03 , lodel-a5dv46 , lodel-a5dw16 , lodel-a5dwv7 , lodel-a5dww6 , lodel-a5dxf3 , lodel-a5e0z5 , lodel-a5e1c1 , lodel-a5e1l4 , lodel-a5e1p3 , lodel-a5e2s1 , lodel-a5e2t8 , lodel-a5e2v2 , lodel-a5e4u8 , lodel-a5e5a9 , lodel-a5e5k1 , lodel-a5e5z7 , lodel-a5e6w1 , lodel-a5e028 , lodel-atg15 , lodel-kex1 , picgu-a5d9u2 , picgu-a5dav0 , picgu-a5dbk0 , picgu-a5dc45 , picgu-a5dc73 , picgu-a5dc74 , picgu-a5dc75 , picgu-a5ddt8 , picgu-a5dev7 , picgu-a5dh90 , picgu-a5dhe3 , picgu-a5di38 , picgu-a5dj06 , picgu-a5dkd8 , picgu-a5dle9 , picgu-a5dlj5 , picgu-a5dm19 , picgu-a5dn92 , picgu-a5dnr3 , picgu-a5dnt6 , picgu-a5dqu5 , picgu-a5dr14 , picgu-a5drl3 , picgu-atg15 , picgu-bna7 , picgu-a5d9q3 , picgu-a5dag9 , clal4-c4y5a2 , clal4-c4y0l0 , cantt-c5mcb1 , clal4-c4y8j2 , cantt-c5m494 , clals-a0a202gac7 , canal-hda1 , picgu-a5dks8 , lodel-a5drs6 , canpc-g8bbk1 , cantt-kex1 , clal4-kex1 , picgu-kex1