canal-LIP5

Candida albicans (Yeast) Candida albicans SC5314 secretory lipase 5 (EC 3.1.1.3)

Comment

Relationship

Family : Fungal-Bact_LIP

Block : X

Position in NCBI Life Tree : Candida albicans

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

MLYLILFLIAPIYAGLIFPTKPSSDPFYNPPKGFENAAVG
DILQSRATPK SITGGFTPLKIQNSWQLLVRSEDSFGNPN
VIVTTVIEPVNADPSKIASYQ VFEDAAKADCAPSYALQF
GSDLTTFVTQAEMYLMAPLLDQGYYVVSPDYE GPKSTFT
IGKQSGQAVLNSIRAALKSGKITNIKDDAKVVMWGYSGGS
LAS GWAAALQPSYAPELGGNLLGAALGGFVTNITATAQA
TDGTVFAGIVANAL GGVANEYPEFKSILQSDTDKKSVFE
EFDGHCLIDGVLNYIGTSFLTGDHK IFKTGWDILKNPKI
GKVVEDNGLVYQKQLVPKIPVFIYHGSIDQIVPIVD TKK
TYQNWCDAGISSLEFAEDASNGHLTEAIMGAPAALTWIID
RFDGKQT VSGCQHIQRFSNLEYPNIPSSIANYFKAAMDV
VLHLGLGPDVQKDQVSPE GIKKLGSIEMRWL

References

Title : A novel cold-active lipase from Candida albicans: cloning, expression and characterization of the recombinant enzyme - Lan_2011_Int.J.Mol.Sci_12_3950
Author(s) : Lan DM , Yang N , Wang WK , Shen YF , Yang B , Wang YH
Ref : Int J Mol Sci , 12 :3950 , 2011
Abstract : Lan_2011_Int.J.Mol.Sci_12_3950
ESTHER : Lan_2011_Int.J.Mol.Sci_12_3950
PubMedSearch : Lan_2011_Int.J.Mol.Sci_12_3950
PubMedID: 21747717
Gene_locus related to this paper: canal-LIP5

Title : Evolution of pathogenicity and sexual reproduction in eight Candida genomes - Butler_2009_Nature_459_657
Author(s) : Butler G , Rasmussen MD , Lin MF , Santos MA , Sakthikumar S , Munro CA , Rheinbay E , Grabherr M , Forche A , Reedy JL , Agrafioti I , Arnaud MB , Bates S , Brown AJ , Brunke S , Costanzo MC , Fitzpatrick DA , de Groot PW , Harris D , Hoyer LL , Hube B , Klis FM , Kodira C , Lennard N , Logue ME , Martin R , Neiman AM , Nikolaou E , Quail MA , Quinn J , Santos MC , Schmitzberger FF , Sherlock G , Shah P , Silverstein KA , Skrzypek MS , Soll D , Staggs R , Stansfield I , Stumpf MP , Sudbery PE , Srikantha T , Zeng Q , Berman J , Berriman M , Heitman J , Gow NA , Lorenz MC , Birren BW , Kellis M , Cuomo CA
Ref : Nature , 459 :657 , 2009
Abstract : Butler_2009_Nature_459_657
ESTHER : Butler_2009_Nature_459_657
PubMedSearch : Butler_2009_Nature_459_657
PubMedID: 19465905
Gene_locus related to this paper: canal-ATG15 , canal-bna7 , canal-c4yl13 , canal-LIP1 , canal-LIP2 , canal-LIP3 , canal-LIP4 , canal-LIP5 , canal-LIP6 , canal-LIP7 , canal-LIP8 , canal-LIP9 , canal-LIP10 , canal-ppme1 , canal-q5a0c9 , canal-q5a2i9 , canal-q5a042 , canal-q5ad17 , canal-q5aeu3 , canal-q5afp8 , canal-q5ag57 , canal-q5ai09 , canal-q5ai12 , canal-q5ajt3 , canal-q5akz5 , canal-q5apu4 , canal-q59l46 , canal-q59m48 , canal-q59nw6 , canal-q59u61 , canal-q59u64 , canal-q59vp0 , canal-q59y97 , canaw-c4ykb1 , canaw-c4yrn6 , canaw-c4yrn9 , canaw-c4yrr3 , canaw-c4yrv3 , canaw-c4ys26 , cantt-c5m3d7 , cantt-c5m3y5 , cantt-c5m4x0 , cantt-c5m5e8 , cantt-c5m5w2 , cantt-c5m8s7 , cantt-c5m9c2 , cantt-c5m465 , cantt-c5m751 , cantt-c5m793 , cantt-c5m893 , cantt-c5ma78 , cantt-c5mag0 , cantt-c5mbb8 , cantt-c5mc53 , cantt-c5md87 , cantt-c5mdy3 , cantt-c5mey7 , cantt-c5mfg0 , cantt-c5mfh8 , cantt-c5mg56 , cantt-c5mgj0 , cantt-c5mh75 , cantt-c5mh80 , cantt-c5mh89 , cantt-c5mhh0 , cantt-c5mhn5 , cantt-c5mij5 , cantt-c5min7 , clal4-c4xvt8 , clal4-c4xwy4 , clal4-c4xy03 , clal4-c4xyx9 , clal4-c4xzz1 , clal4-c4y3e1 , clal4-c4y4f2 , clal4-c4y4w8 , clal4-c4y5j4 , clal4-c4y5j9 , clal4-c4y7z7 , clal4-c4y8q1 , clal4-c4y035 , clal4-c4y481 , clal4-c4y538 , clal4-c4y898 , clal4-c4yas2 , clal4-c4yba6 , clal4-c4yba7 , clal4-c4yc85 , lodel-a5drz3 , lodel-a5ds97 , lodel-a5dsc0 , lodel-a5duu4 , lodel-a5duy7 , lodel-a5dv03 , lodel-a5dv46 , lodel-a5dw16 , lodel-a5dwv7 , lodel-a5dww6 , lodel-a5dxf3 , lodel-a5e0z5 , lodel-a5e1c1 , lodel-a5e1l4 , lodel-a5e1p3 , lodel-a5e2s1 , lodel-a5e2t8 , lodel-a5e2v2 , lodel-a5e4u8 , lodel-a5e5a9 , lodel-a5e5k1 , lodel-a5e5z7 , lodel-a5e6w1 , lodel-a5e028 , lodel-atg15 , lodel-kex1 , picgu-a5d9u2 , picgu-a5dav0 , picgu-a5dbk0 , picgu-a5dc45 , picgu-a5dc73 , picgu-a5dc74 , picgu-a5dc75 , picgu-a5ddt8 , picgu-a5dev7 , picgu-a5dh90 , picgu-a5dhe3 , picgu-a5di38 , picgu-a5dj06 , picgu-a5dkd8 , picgu-a5dle9 , picgu-a5dlj5 , picgu-a5dm19 , picgu-a5dn92 , picgu-a5dnr3 , picgu-a5dnt6 , picgu-a5dqu5 , picgu-a5dr14 , picgu-a5drl3 , picgu-atg15 , picgu-bna7 , picgu-a5d9q3 , picgu-a5dag9 , clal4-c4y5a2 , clal4-c4y0l0 , cantt-c5mcb1 , clal4-c4y8j2 , cantt-c5m494 , clals-a0a202gac7 , canal-hda1 , picgu-a5dks8 , lodel-a5drs6 , canpc-g8bbk1 , cantt-kex1 , clal4-kex1 , picgu-kex1

Title : Sequence finishing and gene mapping for Candida albicans chromosome 7 and syntenic analysis against the Saccharomyces cerevisiae genome - Chibana_2005_Genetics_170_1525
Author(s) : Chibana H , Oka N , Nakayama H , Aoyama T , Magee BB , Magee PT , Mikami Y
Ref : Genetics , 170 :1525 , 2005
Abstract : Chibana_2005_Genetics_170_1525
ESTHER : Chibana_2005_Genetics_170_1525
PubMedSearch : Chibana_2005_Genetics_170_1525
PubMedID: 15937140
Gene_locus related to this paper: canal-cbpy , canal-LIP5 , canal-LIP8 , canal-LIP9 , canal-q5a0c9 , canal-q5afp8 , canal-q5ah37

Title : The diploid genome sequence of Candida albicans - Jones_2004_Proc.Natl.Acad.Sci.U.S.A_101_7329
Author(s) : Jones T , Federspiel NA , Chibana H , Dungan J , Kalman S , Magee BB , Newport G , Thorstenson YR , Agabian N , Magee PT , Davis RW , Scherer S
Ref : Proc Natl Acad Sci U S A , 101 :7329 , 2004
Abstract : Jones_2004_Proc.Natl.Acad.Sci.U.S.A_101_7329
ESTHER : Jones_2004_Proc.Natl.Acad.Sci.U.S.A_101_7329
PubMedSearch : Jones_2004_Proc.Natl.Acad.Sci.U.S.A_101_7329
PubMedID: 15123810
Gene_locus related to this paper: canal-apth1 , canal-ATG15 , canal-bna7 , canal-c4yl13 , canal-cbpy , canal-LIP1 , canal-LIP2 , canal-LIP3 , canal-LIP4 , canal-LIP5 , canal-LIP6 , canal-LIP7 , canal-LIP8 , canal-LIP9 , canal-LIP10 , canal-ppme1 , canal-q5a0c9 , canal-q5a0i7 , canal-q5a2i9 , canal-q5a2u7 , canal-q5a6l4 , canal-q5a042 , canal-q5a948 , canal-q5aa97 , canal-q5abf2 , canal-q5acl5 , canal-q5ad17 , canal-q5adx4 , canal-q5ady2 , canal-q5aeu3 , canal-q5afp8 , canal-q5ag57 , canal-q5ah37 , canal-q5ai09 , canal-q5ai12 , canal-q5ai87 , canal-q5ajt3 , canal-q5ak09 , canal-q5ak29 , canal-q5ak96 , canal-q5akr2 , canal-q5akz5 , canal-q5amg8 , canal-q5amn4 , canal-q5amn7 , canal-q5ams2 , canal-q5ams7 , canal-q5apu4 , canal-q59k70 , canal-q59kl3 , canal-q59l46 , canal-q59ln6 , canal-q59m48 , canal-q59ng0 , canal-q59nl9 , canal-q59nw6 , canal-q59nx4 , canal-q59nx8 , canal-q59s22 , canal-q59tt5 , canal-q59u61 , canal-q59u64 , canal-q59vf1 , canal-q59vp0 , canal-q59we9 , canal-q59xq6 , canal-q59y42 , canal-q59y97 , canaw-c4yrr3 , canal-hda1

Title : Secreted lipases of Candida albicans: cloning, characterisation and expression analysis of a new gene family with at least ten members - Hube_2000_Arch.Microbiol_174_362
Author(s) : Hube B , Stehr F , Bossenz M , Mazur A , Kretschmar M , Schafer W
Ref : Arch Microbiol , 174 :362 , 2000
Abstract : Hube_2000_Arch.Microbiol_174_362
ESTHER : Hube_2000_Arch.Microbiol_174_362
PubMedSearch : Hube_2000_Arch.Microbiol_174_362
PubMedID: 11131027
Gene_locus related to this paper: canal-LIP1 , canal-LIP2 , canal-LIP3 , canal-LIP4 , canal-LIP5 , canal-LIP6 , canal-LIP7 , canal-LIP8 , canal-LIP9 , canal-LIP10

Title : A Candida albicans genome project: cosmid contigs, physical mapping, and gene isolation - Tait_1997_Fungal.Genet.Biol_21_308
Author(s) : Tait E , Simon MC , King S , Brown AJ , Gow NA , Shaw DJ
Ref : Fungal Genet Biol , 21 :308 , 1997
Abstract : Tait_1997_Fungal.Genet.Biol_21_308
ESTHER : Tait_1997_Fungal.Genet.Biol_21_308
PubMedSearch : Tait_1997_Fungal.Genet.Biol_21_308
PubMedID: 9290243
Gene_locus related to this paper: canal-ATG15 , canal-c4yl13 , canal-LIP5