cantt-c5m465

Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast) Putative uncharacterized protein

Comment

"only central part Pfam A DUF726 456 795"

Relationship

Family : Duf_726

Block : X

Position in NCBI Life Tree : Candida tropicalis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

LAGSLAMGLSMGLLAPVIGAGIAAGFTTIGVAGTGGFLAG
VGGTALITTT GVAIGAKVGSKAGARRVGDVHTFEFKPLH
NNKRTNLIVTISGWMNGEMDD VRLPFSTVDPVMGDMFSL
LWEPEMLQSMGQTIGILASEALSTSIQQLLGA TILTALM
SAIQIPMALSKLSYLLDNPWNVSLDRAWKAGKLLAETIVS
GNL GVRPITLVGFSLGARLIYSCLIEMARRGVYGLIENV
IILGSPITINTDQI AEARSVVSGRFVNGYSKKDWILGYL
FRATGGGLSTVAGLSPLKNIEGIEN IDCTEFVEGHMSYR
KAIPKIMKNIGWEV

References

Title : Evolution of pathogenicity and sexual reproduction in eight Candida genomes - Butler_2009_Nature_459_657
Author(s) : Butler G , Rasmussen MD , Lin MF , Santos MA , Sakthikumar S , Munro CA , Rheinbay E , Grabherr M , Forche A , Reedy JL , Agrafioti I , Arnaud MB , Bates S , Brown AJ , Brunke S , Costanzo MC , Fitzpatrick DA , de Groot PW , Harris D , Hoyer LL , Hube B , Klis FM , Kodira C , Lennard N , Logue ME , Martin R , Neiman AM , Nikolaou E , Quail MA , Quinn J , Santos MC , Schmitzberger FF , Sherlock G , Shah P , Silverstein KA , Skrzypek MS , Soll D , Staggs R , Stansfield I , Stumpf MP , Sudbery PE , Srikantha T , Zeng Q , Berman J , Berriman M , Heitman J , Gow NA , Lorenz MC , Birren BW , Kellis M , Cuomo CA
Ref : Nature , 459 :657 , 2009
Abstract : Butler_2009_Nature_459_657
ESTHER : Butler_2009_Nature_459_657
PubMedSearch : Butler_2009_Nature_459_657
PubMedID: 19465905
Gene_locus related to this paper: canal-ATG15 , canal-bna7 , canal-c4yl13 , canal-LIP1 , canal-LIP2 , canal-LIP3 , canal-LIP4 , canal-LIP5 , canal-LIP6 , canal-LIP7 , canal-LIP8 , canal-LIP9 , canal-LIP10 , canal-ppme1 , canal-q5a0c9 , canal-q5a2i9 , canal-q5a042 , canal-q5ad17 , canal-q5aeu3 , canal-q5afp8 , canal-q5ag57 , canal-q5ai09 , canal-q5ai12 , canal-q5ajt3 , canal-q5akz5 , canal-q5apu4 , canal-q59l46 , canal-q59m48 , canal-q59nw6 , canal-q59u61 , canal-q59u64 , canal-q59vp0 , canal-q59y97 , canaw-c4ykb1 , canaw-c4yrn6 , canaw-c4yrn9 , canaw-c4yrr3 , canaw-c4yrv3 , canaw-c4ys26 , cantt-c5m3d7 , cantt-c5m3y5 , cantt-c5m4x0 , cantt-c5m5e8 , cantt-c5m5w2 , cantt-c5m8s7 , cantt-c5m9c2 , cantt-c5m465 , cantt-c5m751 , cantt-c5m793 , cantt-c5m893 , cantt-c5ma78 , cantt-c5mag0 , cantt-c5mbb8 , cantt-c5mc53 , cantt-c5md87 , cantt-c5mdy3 , cantt-c5mey7 , cantt-c5mfg0 , cantt-c5mfh8 , cantt-c5mg56 , cantt-c5mgj0 , cantt-c5mh75 , cantt-c5mh80 , cantt-c5mh89 , cantt-c5mhh0 , cantt-c5mhn5 , cantt-c5mij5 , cantt-c5min7 , clal4-c4xvt8 , clal4-c4xwy4 , clal4-c4xy03 , clal4-c4xyx9 , clal4-c4xzz1 , clal4-c4y3e1 , clal4-c4y4f2 , clal4-c4y4w8 , clal4-c4y5j4 , clal4-c4y5j9 , clal4-c4y7z7 , clal4-c4y8q1 , clal4-c4y035 , clal4-c4y481 , clal4-c4y538 , clal4-c4y898 , clal4-c4yas2 , clal4-c4yba6 , clal4-c4yba7 , clal4-c4yc85 , lodel-a5drz3 , lodel-a5ds97 , lodel-a5dsc0 , lodel-a5duu4 , lodel-a5duy7 , lodel-a5dv03 , lodel-a5dv46 , lodel-a5dw16 , lodel-a5dwv7 , lodel-a5dww6 , lodel-a5dxf3 , lodel-a5e0z5 , lodel-a5e1c1 , lodel-a5e1l4 , lodel-a5e1p3 , lodel-a5e2s1 , lodel-a5e2t8 , lodel-a5e2v2 , lodel-a5e4u8 , lodel-a5e5a9 , lodel-a5e5k1 , lodel-a5e5z7 , lodel-a5e6w1 , lodel-a5e028 , lodel-atg15 , lodel-kex1 , picgu-a5d9u2 , picgu-a5dav0 , picgu-a5dbk0 , picgu-a5dc45 , picgu-a5dc73 , picgu-a5dc74 , picgu-a5dc75 , picgu-a5ddt8 , picgu-a5dev7 , picgu-a5dh90 , picgu-a5dhe3 , picgu-a5di38 , picgu-a5dj06 , picgu-a5dkd8 , picgu-a5dle9 , picgu-a5dlj5 , picgu-a5dm19 , picgu-a5dn92 , picgu-a5dnr3 , picgu-a5dnt6 , picgu-a5dqu5 , picgu-a5dr14 , picgu-a5drl3 , picgu-atg15 , picgu-bna7 , picgu-a5d9q3 , picgu-a5dag9 , clal4-c4y5a2 , clal4-c4y0l0 , cantt-c5mcb1 , clal4-c4y8j2 , cantt-c5m494 , clals-a0a202gac7 , canal-hda1 , picgu-a5dks8 , lodel-a5drs6 , canpc-g8bbk1 , cantt-kex1 , clal4-kex1 , picgu-kex1