canal-q5ajt3

Candida albicans (Yeast). hypothetical protein

Comment

"Other strains Candida albicans (strains SC5314\; WO-1) (Yeast)"

Relationship

Family : Fusarinine_C_esterase_sidJ

Block : X

Position in NCBI Life Tree : Candida albicans SC5314

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSLKLVPQQRGIVHTYGFNLTAFEFTTDPSNISPNIILFV
GGLGNGLLNI PYLPELADSASNEFQSTDGGSWSLVQVLL
SSAYQGWGTSSLDRDTSELQS AIEYFRSERGGNRQKIVI
MGHSTGCQDVIHYLTKTLYKENIPETSQVQGG ILQAPVS
DSEALSSGRDPTKHEALVQRVYDEYISKGKESEILPQEYR
KLT WGVPTSAYRFYSLASKRGDDDYFSSYLTQEDYTKSF
GKVNKPLLVLYGSI DEFVPEYVDKENLVSTWKQSTSSQY
WSEHSQIIKGATHNLGDGSDAGVIE HLVSVVKKFISDL

References

Title : Evolution of pathogenicity and sexual reproduction in eight Candida genomes - Butler_2009_Nature_459_657
Author(s) : Butler G , Rasmussen MD , Lin MF , Santos MA , Sakthikumar S , Munro CA , Rheinbay E , Grabherr M , Forche A , Reedy JL , Agrafioti I , Arnaud MB , Bates S , Brown AJ , Brunke S , Costanzo MC , Fitzpatrick DA , de Groot PW , Harris D , Hoyer LL , Hube B , Klis FM , Kodira C , Lennard N , Logue ME , Martin R , Neiman AM , Nikolaou E , Quail MA , Quinn J , Santos MC , Schmitzberger FF , Sherlock G , Shah P , Silverstein KA , Skrzypek MS , Soll D , Staggs R , Stansfield I , Stumpf MP , Sudbery PE , Srikantha T , Zeng Q , Berman J , Berriman M , Heitman J , Gow NA , Lorenz MC , Birren BW , Kellis M , Cuomo CA
Ref : Nature , 459 :657 , 2009
Abstract : Butler_2009_Nature_459_657
ESTHER : Butler_2009_Nature_459_657
PubMedSearch : Butler_2009_Nature_459_657
PubMedID: 19465905
Gene_locus related to this paper: canal-ATG15 , canal-bna7 , canal-c4yl13 , canal-LIP1 , canal-LIP2 , canal-LIP3 , canal-LIP4 , canal-LIP5 , canal-LIP6 , canal-LIP7 , canal-LIP8 , canal-LIP9 , canal-LIP10 , canal-ppme1 , canal-q5a0c9 , canal-q5a2i9 , canal-q5a042 , canal-q5ad17 , canal-q5aeu3 , canal-q5afp8 , canal-q5ag57 , canal-q5ai09 , canal-q5ai12 , canal-q5ajt3 , canal-q5akz5 , canal-q5apu4 , canal-q59l46 , canal-q59m48 , canal-q59nw6 , canal-q59u61 , canal-q59u64 , canal-q59vp0 , canal-q59y97 , canaw-c4ykb1 , canaw-c4yrn6 , canaw-c4yrn9 , canaw-c4yrr3 , canaw-c4yrv3 , canaw-c4ys26 , cantt-c5m3d7 , cantt-c5m3y5 , cantt-c5m4x0 , cantt-c5m5e8 , cantt-c5m5w2 , cantt-c5m8s7 , cantt-c5m9c2 , cantt-c5m465 , cantt-c5m751 , cantt-c5m793 , cantt-c5m893 , cantt-c5ma78 , cantt-c5mag0 , cantt-c5mbb8 , cantt-c5mc53 , cantt-c5md87 , cantt-c5mdy3 , cantt-c5mey7 , cantt-c5mfg0 , cantt-c5mfh8 , cantt-c5mg56 , cantt-c5mgj0 , cantt-c5mh75 , cantt-c5mh80 , cantt-c5mh89 , cantt-c5mhh0 , cantt-c5mhn5 , cantt-c5mij5 , cantt-c5min7 , clal4-c4xvt8 , clal4-c4xwy4 , clal4-c4xy03 , clal4-c4xyx9 , clal4-c4xzz1 , clal4-c4y3e1 , clal4-c4y4f2 , clal4-c4y4w8 , clal4-c4y5j4 , clal4-c4y5j9 , clal4-c4y7z7 , clal4-c4y8q1 , clal4-c4y035 , clal4-c4y481 , clal4-c4y538 , clal4-c4y898 , clal4-c4yas2 , clal4-c4yba6 , clal4-c4yba7 , clal4-c4yc85 , lodel-a5drz3 , lodel-a5ds97 , lodel-a5dsc0 , lodel-a5duu4 , lodel-a5duy7 , lodel-a5dv03 , lodel-a5dv46 , lodel-a5dw16 , lodel-a5dwv7 , lodel-a5dww6 , lodel-a5dxf3 , lodel-a5e0z5 , lodel-a5e1c1 , lodel-a5e1l4 , lodel-a5e1p3 , lodel-a5e2s1 , lodel-a5e2t8 , lodel-a5e2v2 , lodel-a5e4u8 , lodel-a5e5a9 , lodel-a5e5k1 , lodel-a5e5z7 , lodel-a5e6w1 , lodel-a5e028 , lodel-atg15 , lodel-kex1 , picgu-a5d9u2 , picgu-a5dav0 , picgu-a5dbk0 , picgu-a5dc45 , picgu-a5dc73 , picgu-a5dc74 , picgu-a5dc75 , picgu-a5ddt8 , picgu-a5dev7 , picgu-a5dh90 , picgu-a5dhe3 , picgu-a5di38 , picgu-a5dj06 , picgu-a5dkd8 , picgu-a5dle9 , picgu-a5dlj5 , picgu-a5dm19 , picgu-a5dn92 , picgu-a5dnr3 , picgu-a5dnt6 , picgu-a5dqu5 , picgu-a5dr14 , picgu-a5drl3 , picgu-atg15 , picgu-bna7 , picgu-a5d9q3 , picgu-a5dag9 , clal4-c4y5a2 , clal4-c4y0l0 , cantt-c5mcb1 , clal4-c4y8j2 , cantt-c5m494 , clals-a0a202gac7 , canal-hda1 , picgu-a5dks8 , lodel-a5drs6 , canpc-g8bbk1 , cantt-kex1 , clal4-kex1 , picgu-kex1

Title : The diploid genome sequence of Candida albicans - Jones_2004_Proc.Natl.Acad.Sci.U.S.A_101_7329
Author(s) : Jones T , Federspiel NA , Chibana H , Dungan J , Kalman S , Magee BB , Newport G , Thorstenson YR , Agabian N , Magee PT , Davis RW , Scherer S
Ref : Proc Natl Acad Sci U S A , 101 :7329 , 2004
Abstract : Jones_2004_Proc.Natl.Acad.Sci.U.S.A_101_7329
ESTHER : Jones_2004_Proc.Natl.Acad.Sci.U.S.A_101_7329
PubMedSearch : Jones_2004_Proc.Natl.Acad.Sci.U.S.A_101_7329
PubMedID: 15123810
Gene_locus related to this paper: canal-apth1 , canal-ATG15 , canal-bna7 , canal-c4yl13 , canal-cbpy , canal-LIP1 , canal-LIP2 , canal-LIP3 , canal-LIP4 , canal-LIP5 , canal-LIP6 , canal-LIP7 , canal-LIP8 , canal-LIP9 , canal-LIP10 , canal-ppme1 , canal-q5a0c9 , canal-q5a0i7 , canal-q5a2i9 , canal-q5a2u7 , canal-q5a6l4 , canal-q5a042 , canal-q5a948 , canal-q5aa97 , canal-q5abf2 , canal-q5acl5 , canal-q5ad17 , canal-q5adx4 , canal-q5ady2 , canal-q5aeu3 , canal-q5afp8 , canal-q5ag57 , canal-q5ah37 , canal-q5ai09 , canal-q5ai12 , canal-q5ai87 , canal-q5ajt3 , canal-q5ak09 , canal-q5ak29 , canal-q5ak96 , canal-q5akr2 , canal-q5akz5 , canal-q5amg8 , canal-q5amn4 , canal-q5amn7 , canal-q5ams2 , canal-q5ams7 , canal-q5apu4 , canal-q59k70 , canal-q59kl3 , canal-q59l46 , canal-q59ln6 , canal-q59m48 , canal-q59ng0 , canal-q59nl9 , canal-q59nw6 , canal-q59nx4 , canal-q59nx8 , canal-q59s22 , canal-q59tt5 , canal-q59u61 , canal-q59u64 , canal-q59vf1 , canal-q59vp0 , canal-q59we9 , canal-q59xq6 , canal-q59y42 , canal-q59y97 , canaw-c4yrr3 , canal-hda1