thema-TM0033

Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)a EstA hypothetical 44.8 kda protein

Comment

"Novel Thermostable Esterase Containing an N-terminal Immunoglobulin-Like Domain"

Relationship

Family : 5_AlphaBeta_hydrolase

Block : X

Position in NCBI Life Tree : Thermotoga maritima

Molecular evidence

No mutation

No kinetic

No disease

No substrate

Database

Sequence

Peptide

MLFFIFMGILSILFAQEDVTVKSVTLITKVFPEGEKVCAV
VIEYPVEIDG QKLSPDQFSVKVKTGDTYSSRTITKVYAN
NSGGLSFSIFNNRGKYVVLEL STEDLHSNTIVFGPNFLN
TRMKLDYIVSQLVPIFDVDGNEVEPFTSKQTD EKHLIID
DFLAFTFKDPETGVEIPYRLFVPKDVNPDRKYPLVVFLHG
AGE RGTDNYLQVAGNRGAVVWAQPRYQVVHPCFVLAPQC
PPNSSWSTLFTDRE NPFNPEKPLLAVIKIIRKLLDEYNI
DENRIYITGLSMGGYGTWTAIMEFP ELFAAAIPICGGGD
VSKVERIKDIPIWVFHAEDDPVVPVENSRVLVKKLA EIG
GKVRYTEYEKGFMEKHGWDPHGSWIPTYENQEAIEWLFEQ
SR

References

Title : Crystal structure and biochemical properties of a novel thermostable esterase containing an immunoglobulin-like domain - Levisson_2009_J.Mol.Biol_385_949
Author(s) : Levisson M , Sun L , Hendriks S , Swinkels P , Akveld T , Bultema JB , Barendregt A , van den Heuvel RH , Dijkstra BW , Van der Oost J , Kengen SW
Ref : Journal of Molecular Biology , 385 :949 , 2009
Abstract : Levisson_2009_J.Mol.Biol_385_949
ESTHER : Levisson_2009_J.Mol.Biol_385_949
PubMedSearch : Levisson_2009_J.Mol.Biol_385_949
PubMedID: 19013466
Gene_locus related to this paper: thema-TM0033

Title : Crystallization and preliminary crystallographic analysis of an esterase with a novel domain from the hyperthermophile Thermotoga maritima - Sun_2007_Acta.Crystallogr.Sect.F.Struct.Biol.Cryst.Commun_63_777
Author(s) : Sun L , Levisson M , Hendriks S , Akveld T , Kengen SW , Dijkstra BW , Van der Oost J
Ref : Acta Crystallographica Sect F Struct Biol Cryst Commun , 63 :777 , 2007
Abstract : Sun_2007_Acta.Crystallogr.Sect.F.Struct.Biol.Cryst.Commun_63_777
ESTHER : Sun_2007_Acta.Crystallogr.Sect.F.Struct.Biol.Cryst.Commun_63_777
PubMedSearch : Sun_2007_Acta.Crystallogr.Sect.F.Struct.Biol.Cryst.Commun_63_777
PubMedID: 17768353
Gene_locus related to this paper: thema-TM0033

Title : Evidence for lateral gene transfer between Archaea and bacteria from genome sequence of Thermotoga maritima - Nelson_1999_Nature_399_323
Author(s) : Nelson KE , Clayton RA , Gill SR , Gwinn ML , Dodson RJ , Haft DH , Hickey EK , Peterson JD , Nelson WC , Ketchum KA , McDonald L , Utterback TR , Malek JA , Linher KD , Garrett MM , Stewart AM , Cotton MD , Pratt MS , Phillips CA , Richardson D , Heidelberg J , Sutton GG , Fleischmann RD , Eisen JA , White O , Salzberg SL , Smith HO , Venter JC , Fraser CM
Ref : Nature , 399 :323 , 1999
Abstract : Nelson_1999_Nature_399_323
ESTHER : Nelson_1999_Nature_399_323
PubMedSearch : Nelson_1999_Nature_399_323
PubMedID: 10360571
Gene_locus related to this paper: thema-ESTA , thema-q9x0d6 , thema-q9x042 , thema-TM0033 , thema-TM0053 , thema-TM0077 , thema-TM0336 , thema-TM1160 , thema-TM1350