yarli-q6cdg1

Yarrowia lipolytica (Candida lipolytica) similar to sp|p30574 candida albicans carboxypeptidase y

Comment

Relationship

Family : Carboxypeptidase_S10

Block : X

Position in NCBI Life Tree : Yarrowia lipolytica

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MVPLKPLHTAPRNSTSPHDDQSCLTVVQTLYTNSCHVNLP
RRQAPRWAEH SCASPVLKRLSSPTICSPHLAQSTFPQIK
MLFPQLLLATVAMGFSLESIP NRSLSSQKNNGLGLDTVT
EYTGYLTANETEHFFYWAFESRNDPKNDPVIL WLQGGPG
SSSELGNLFENGPSRIGKDLKPIHNPHAWNNNATIVYLDQ
PAD VGFSYTDKPHSVVNSAQAATEVYNFLELFFAKYDHL
PKKLHVTAESYGGH YGPATAYEILQHPDRSFTLESLVVG
NGMTDPLNQYTEYGPMMCGKGGVAP VVDQSTCQQVDEAA
KECIPLIQKCYDTGAPQDCADAVNNCNDNVLGLYPS SLN
PYDETKQCEQAQDDGCYTETDYMTEWLNLPSTLEAIGAKH
NWTGSSG TVYNDFTETSGDWMLPVVRDIPAILKEVPVLI
YAGDKDWICNWLGQKKWT EALEWPGKQGFNDAQFKPFSA
GGKQAGEVRNYQQFTFLRIFDAGHMVPHD QPVATSEMIN
RWMSGDHQLE

References

Title : Genome evolution in yeasts - Dujon_2004_Nature_430_35
Author(s) : Dujon B , Sherman D , Fischer G , Durrens P , Casaregola S , Lafontaine I , De Montigny J , Marck C , Neuveglise C , Talla E , Goffard N , Frangeul L , Aigle M , Anthouard V , Babour A , Barbe V , Barnay S , Blanchin S , Beckerich JM , Beyne E , Bleykasten C , Boisrame A , Boyer J , Cattolico L , Confanioleri F , de Daruvar A , Despons L , Fabre E , Fairhead C , Ferry-Dumazet H , Groppi A , Hantraye F , Hennequin C , Jauniaux N , Joyet P , Kachouri R , Kerrest A , Koszul R , Lemaire M , Lesur I , Ma L , Muller H , Nicaud JM , Nikolski M , Oztas S , Ozier-Kalogeropoulos O , Pellenz S , Potier S , Richard GF , Straub ML , Suleau A , Swennen D , Tekaia F , Wesolowski-Louvel M , Westhof E , Wirth B , Zeniou-Meyer M , Zivanovic I , Bolotin-Fukuhara M , Thierry A , Bouchier C , Caudron B , Scarpelli C , Gaillardin C , Weissenbach J , Wincker P , Souciet JL
Ref : Nature , 430 :35 , 2004
Abstract : Dujon_2004_Nature_430_35
ESTHER : Dujon_2004_Nature_430_35
PubMedSearch : Dujon_2004_Nature_430_35
PubMedID: 15229592
Gene_locus related to this paper: canga-apth1 , canga-ppme1 , canga-q6fik7 , canga-q6fiv5 , canga-q6fiw8 , canga-q6fj11 , canga-q6fjh6 , canga-q6fjl0 , canga-q6fjr8 , canga-q6fkj6 , canga-q6fkm9 , canga-q6fku7 , canga-q6fl14 , canga-q6flb5 , canga-q6fle9 , canga-q6flk8 , canga-q6fly1 , canga-q6fly9 , canga-q6fmz4 , canga-q6fnx4 , canga-q6fp28 , canga-q6fpa8 , canga-q6fpi6 , canga-q6fpv7 , canga-q6fpw6 , canga-q6fqj3 , canga-q6fr97 , canga-q6frt7 , canga-q6ftm9 , canga-q6ftu0 , canga-q6ftv9 , canga-q6ftz9 , canga-q6fuf8 , canga-q6fv41 , canga-q6fvu3 , canga-q6fw36 , canga-q6fw94 , canga-q6fwk6 , canga-q6fwm0 , canga-q6fxc7 , canga-q6fxd7 , debha-apth1 , debha-atg15 , debha-b5rtk1 , debha-b5rub4 , debha-b5rue8 , debha-b5rue9 , debha-bna7 , debha-ppme1 , debha-q6bgx3 , debha-q6bh69 , debha-q6bhb8 , debha-q6bhc1 , debha-q6bhd0 , debha-q6bhj7 , debha-q6bi97 , debha-q6biq7 , debha-q6bj53 , debha-q6bkd8 , debha-q6bks1 , debha-q6bky4 , debha-q6bm63 , debha-q6bmh3 , debha-q6bn89 , debha-q6bnj6 , debha-q6bp08 , debha-q6bpb4 , debha-q6bpc0 , debha-q6bpc6 , debha-q6bq10 , debha-q6bq11 , debha-q6bqd9 , debha-q6bqj6 , debha-q6br33 , debha-q6br93 , debha-q6brg1 , debha-q6brw7 , debha-q6bs23 , debha-q6bsc3 , debha-q6bsl8 , debha-q6bsx6 , debha-q6bta5 , debha-q6bty5 , debha-q6btz0 , debha-q6bu73 , debha-q6buk9 , debha-q6but7 , debha-q6bvc4 , debha-q6bvg4 , debha-q6bvg8 , debha-q6bvp4 , debha-q6bw82 , debha-q6bxr7 , debha-q6bxu9 , debha-q6bym5 , debha-q6byn7 , debha-q6bzj8 , debha-q6bzk2 , debha-q6bzm5 , klula-apth1 , klula-ppme1 , klula-q6cin9 , klula-q6ciu6 , klula-q6cj47 , klula-q6cjc8 , klula-q6cjq9 , klula-q6cjs1 , klula-q6cjv9 , klula-q6ckd7 , klula-q6ckk4 , klula-q6ckx4 , klula-q6cl20 , klula-q6clm1 , klula-q6cly8 , klula-q6clz7 , klula-q6cm48 , klula-q6cm49 , klula-q6cmt5 , klula-q6cn71 , klula-q6cnm1 , klula-q6cr74 , klula-q6cr90 , klula-q6crs0 , klula-q6crv8 , klula-q6crz9 , klula-q6cst8 , klula-q6csv8 , klula-q6ctp8 , klula-q6cu02 , klula-q6cu78 , klula-q6cu79 , klula-q6cuv3 , klula-q6cvd3 , klula-q6cw70 , klula-q6cw92 , klula-q6cwu7 , klula-q6cx84 , klula-q6cxa3 , klula-q6cy41 , yarli-apth1 , yarli-atg15 , yarli-BST1B , yarli-lip2 , yarli-LIP3 , yarli-LIP4 , yarli-LIP5 , yarli-LIP7 , yarli-LIP8 , yarli-lipa1 , yarli-ppme1 , yarli-q6bzp1 , yarli-q6bzv7 , yarli-q6c1f5 , yarli-q6c1f7 , yarli-q6c1r3 , yarli-q6c2z2 , yarli-q6c3h1 , yarli-q6c3i6 , yarli-q6c3l1 , yarli-q6c3u6 , yarli-q6c4h8 , yarli-q6c5j1 , yarli-q6c5m4 , yarli-q6c6m4 , yarli-q6c6p7 , yarli-q6c6v2 , yarli-q6c7h3 , yarli-q6c7i7 , yarli-q6c7j5 , yarli-q6c7y6 , yarli-q6c8m4 , yarli-q6c8q4 , yarli-q6c8u4 , yarli-q6c8y2 , yarli-q6c9r0 , yarli-q6c9r1 , yarli-q6c9u0 , yarli-q6c9v4 , yarli-q6c209 , yarli-q6c225 , yarli-q6c493 , yarli-q6c598 , yarli-q6c687 , yarli-q6c822 , yarli-q6cau6 , yarli-q6cax2 , yarli-q6caz1 , yarli-q6cb63 , yarli-q6cba7 , yarli-q6cbb1 , yarli-q6cbe6 , yarli-q6cby1 , yarli-q6ccr0 , yarli-q6cdg1 , yarli-q6cdi6 , yarli-q6cdv9 , yarli-q6ce37 , yarli-q6ceg0 , yarli-q6cep3 , yarli-q6cey5 , yarli-q6cf60 , yarli-q6cfp3 , yarli-q6cfx2 , yarli-q6cg13 , yarli-q6cg27 , yarli-q6cgj3 , yarli-q6chb8 , yarli-q6ci59 , yarli-q6c748 , canga-q6fpj0 , klula-q6cp11 , yarli-q6c4p0 , debha-q6btp5 , debha-kex1