Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9sach-a0a0p1kuu1

Lachancea quebecensis; Lachancea thermotolerans (Yeast) (Kluyveromyces thermotolerans). LAQU0S13e01552g1_1

Comment
Other strains: Lachancea quebecensis; Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)


Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Lachancea quebecensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Lachancea: N E > Lachancea quebecensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : LN890566, CU928171, XP_002555483.1
2 UniProt : A0A0P1KUU1, C5DMN5
2 UniProt : A0A0P1KUU1, C5DMN5
2 Interpro : A0A0P1KUU1, C5DMN5
2 Prodom : A0A0P1KUU1, C5DMN5
2 Pfam : A0A0P1KUU1, C5DMN5
2 PIRSF : A0A0P1KUU1, C5DMN5
2 SUPERFAM : A0A0P1KUU1, C5DMN5
Sequence
Graphical view for this peptide sequence: 9sach-a0a0p1kuu1
Colored MSA for Arb2_domain (raw)
PLQNAIRQQQLRLLANEFRFVTLPLFKKELPDDTVICSPNIYDASAIIVC
VHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQ
SLHEQDNYSAIITAQEVLVHIWDNYLKYFPSLNKVAFVAIGDAHSGVVHL
LGHRDTRSVVKSAVSFVDRRPLRPLIPLVDETLADWYFKNSLVFASAEHT
CWGNDSNENKKPRKKFGRVLKCDSDGLNNILEERFEEATDFILDTFEEWS
DSE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

PLQNAIRQQQLRLLANEFRFVTLPLFKKELPDDTVICSPNIYDASAIIVC
VHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQ
SLHEQDNYSAIITAQEVLVHIWDNYLKYFPSLNKVAFVAIGDAHSGVVHL
LGHRDTRSVVKSAVSFVDRRPLRPLIPLVDETLADWYFKNSLVFASAEHT
CWGNDSNENKKPRKKFGRVLKCDSDGLNNILEERFEEATDFILDTFEEWS
DSE


Reference
    Title: Comparative genomics of protoploid Saccharomycetaceae
    Souciet JL, Dujon B, Gaillardin C, Johnston M, Baret PV, Cliften P, Sherman DJ, Weissenbach J, Westhof E and Talla E <44 more author(s)>
    Ref: Genome Res, 19:1696, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer