arath-LIP2

 
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) Triacylglycerol lipase 2 gene At5g1418 MUA22.18 MUA22.19 MYZUS PERSICAE-INDUCED LIPASE 1

Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 3 more: AB007650, AY048236, AY091711
2 UniProt : Q67ZU1, D7M611
1 Ncbi-nid : 2564050
2 Ncbi-pid : 9757799, 9757800
>3 UniProtTrembl links 2 more: Q67ZU1, A0A1P8BB68, A0A1P8BB89
>3 Interpro links 2 more: Q67ZU1, A0A1P8BB68, A0A1P8BB89
>3 Prodom links 2 more: Q67ZU1, A0A1P8BB68, A0A1P8BB89
>3 Pfam links 2 more: Q67ZU1, A0A1P8BB68, A0A1P8BB89
>3 PIRSF links 2 more: Q67ZU1, A0A1P8BB68, A0A1P8BB89
>3 SUPERFAM links 2 more: Q67ZU1, A0A1P8BB68, A0A1P8BB89
>3 QuickSwissBlast links 2 more: Q67ZU1, A0A1P8BB68, A0A1P8BB89
1 Tair database : At5g14180
 
Sequence
Graphical view for this peptide sequence: arath-LIP2
Colored MSA for Acidic_Lipase (raw)
MSWLLNPADQNLPLILADQGFDVWMGNTRGTRFSRRHKYLNPSQRAFWNW
TWDELVSYDLPAMFDHIHGLTGQKIHYLGHSLVGPTICFVLRKRVGGSSE
IGGDVESRCLSQPHDHRHRRYRRKNLPRRVMKITCLSSFKNRPPLFLDGQ
SLTRKVGDFIKAICLKAGIDCYDLVSVITGKNCCLNASTIDLFLANEPQS
TSTKNMIHLAQTVRDKELRKYNYGSSDRNIKHYGQAIPPAYNISAIPHEL
PLFFSYGGLDSLADVKDVEFLLDQFKYHDIDKMNVQFVKDYAHADFIMGV
TAKDVVYNQVATFFKRQA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSWLLNPADQNLPLILADQGFDVWMGNTRGTRFSRRHKYLNPSQRAFWNW
TWDELVSYDLPAMFDHIHGLTGQKIHYLGHSLVGPTICFVLRKRVGGSSE
IGGDVESRCLSQPHDHRHRRYRRKNLPRRVMKITCLSSFKNRPPLFLDGQ
SLTRKVGDFIKAICLKAGIDCYDLVSVITGKNCCLNASTIDLFLANEPQS
TSTKNMIHLAQTVRDKELRKYNYGSSDRNIKHYGQAIPPAYNISAIPHEL
PLFFSYGGLDSLADVKDVEFLLDQFKYHDIDKMNVQFVKDYAHADFIMGV
TAKDVVYNQVATFFKRQA

Graphical view for this nucleotide DNA sequence (1513 bp): arath-LIP2



References
1 more
    Title: Opposing effects of MYZUS PERSICAE-INDUCED LIPASE 1 and jasmonic acid influence the outcome of Arabidopsis thaliana-Fusarium graminearum interaction
    Alam ST, Sarowar S, Mondal HA, Makandar R, Chowdhury Z, Louis J, Shah J
    Ref: Mol Plant Pathol, :, 2022 : PubMed

            

    Title: Antibiosis against the green peach aphid requires the Arabidopsis thaliana MYZUS PERSICAE-INDUCED LIPASE1 gene
    Louis J, Lorenc-Kukula K, Singh V, Reese J, Jander G, Shah J
    Ref: Plant J, 64:800, 2010 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 5. III. Sequence features of the regions of 1,191,918 bp covered by seventeen physically assigned P1 clones
    Nakamura Y, Sato S, Kaneko T, Kotani H, Asamizu E, Miyajima N, Tabata S
    Ref: DNA Research, 4:401, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer