aspfu-q4wmr0

 
Aspergillus fumigatus Af293 (strain CEA10/CBS 144.89/FGSC A1163)(Sartorya fumigata) Ferulic acid esterase B-2

Relationship
Family Tannase
Block X
Aspergillus fumigatus Af293 position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E > Aspergillus fumigatus Af293: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AAHF01000006, DS499599
2 UniProt : Q4WMR0, B0Y7U1
2 UniProtTrembl : Q4WMR0, B0Y7U1
2 Interpro : Q4WMR0, B0Y7U1
2 Prodom : Q4WMR0, B0Y7U1
2 Pfam : Q4WMR0, B0Y7U1
2 PIRSF : Q4WMR0, B0Y7U1
2 SUPERFAM : Q4WMR0, B0Y7U1
2 QuickSwissBlast : Q4WMR0, B0Y7U1
 
Sequence
Graphical view for this peptide sequence: aspfu-q4wmr0
Colored MSA for Tannase (raw)
MTKLSLLPLLTLASAVLAKQDAFQAKCASFGRKIKLPNVHVNFVEYVPGG
TNLTLPDNDVTCGASSQVVSADMCRVAMAVDTSKSSQITLEAWFPREYTG
RFLSTGNGGLSGCIQYYDLAYTAGLGFATVGANNGHNGTSGKPFYQHPEV
IEDFAYRSIHTGVVVGKQLTKMFYKEGFDKSYYLGCSTGGRQGFKSIQKY
PNDFDGVVAGAPAFNFVNLISWSIHFYSITGSNTSDTYLSPESWKVVHDE
IVRQCDEIDGAKDGIIEDTDLCQPVIETIICKPGASDKTNCITGAQAKTV
RNVLSPFYGVNGNLLYPRMQPGSELFASSVVYNGQPFRYSTDWYRYVVYN
NPDWDATKWTVEDAAVALAQNPYNIQTWDADISSFQKAGGKVLTYHGMQD
QLISSDNSKLYYARVAEEMGLGPEELDDFYRFFPVSGMAHCTGGDGAYGI
GNGLRTYNGAEPENNVLMAMVQWVEKGIAPEFIRGAKFSNGVGSSVEYTR
KHCRYPRRNVYKGPGNYSDENAWECV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTKLSLLPLLTLASAVLAKQDAFQAKCASFGRKIKLPNVHVNFVEYVPGG
TNLTLPDNDVTCGASSQVVSADMCRVAMAVDTSKSSQITLEAWFPREYTG
RFLSTGNGGLSGCIQYYDLAYTAGLGFATVGANNGHNGTSGKPFYQHPEV
IEDFAYRSIHTGVVVGKQLTKMFYKEGFDKSYYLGCSTGGRQGFKSIQKY
PNDFDGVVAGAPAFNFVNLISWSIHFYSITGSNTSDTYLSPESWKVVHDE
IVRQCDEIDGAKDGIIEDTDLCQPVIETIICKPGASDKTNCITGAQAKTV
RNVLSPFYGVNGNLLYPRMQPGSELFASSVVYNGQPFRYSTDWYRYVVYN
NPDWDATKWTVEDAAVALAQNPYNIQTWDADISSFQKAGGKVLTYHGMQD
QLISSDNSKLYYARVAEEMGLGPEELDDFYRFFPVSGMAHCTGGDGAYGI
GNGLRTYNGAEPENNVLMAMVQWVEKGIAPEFIRGAKFSNGVGSSVEYTR
KHCRYPRRNVYKGPGNYSDENAWECV

no DNA




Reference
    Title: Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus
    Fedorova ND, Khaldi N, Joardar VS, Maiti R, Amedeo P, Anderson MJ, Crabtree J, Silva JC, Badger JH and Nierman WC <29 more author(s)>
    Ref: PLoS Genet, 4:e1000046, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer