aspfc-dpp5

Aspergillus fumigatus (strain CEA10/CBS 144.89/FGSC A1163) (Sartorya fumigata)(and strain Af293) Dipeptidyl-peptidase V

Comment

Relationship

Family : Prolyl_oligopeptidase_S9

Block : X

Position in NCBI Life Tree : Aspergillus fumigatus

Molecular evidence

No mutation

No structure

No kinetic

No disease

No inhibitor

Database

Sequence

Peptide

MGAFRWLSIAAAASTALALTPEQLITAPRRSEAIPDPSGK
VAVFSTSQYS FETHKRTSWWSLLDLKTGQTKVLTNDSSV
SEIVWLSDDSILYVNSTNADI PGGVELWVTQASSFAKGY
KAASLPASFSGLKAAKTKSGDIRFVAYGQSYP NGTAYNE
ELATAPLSSARIYDSIYVRHWDYWLSTTFNAVFSGTLKKG
HGK NGYSLDGELKNLVSPVKNAESPYPPFGGASDYDLSP
DGKWVAFKSKAPEL PKANFTTSYIYLVPHDASETARPIN
GPDSPGTPKGIKGDSSSPVFSPNGD KLAYFQMRDETYES
DRRVLYVYSLGSKKTIPSVAGDWDRSPDSVKWTPDG KTL
IVGSEDLGRTRLFSLPANAKDDYKPKNFTDGGSVSAYYFL
PDSSLLV TGSALWTNWNVYTAKPEKGVIKKIASANEIDP
ELKGLGPSDISEFYFQGN FTDIHAWVIYPENFDKSKKYP
LIFFIHGGPQGNWADGWSTRWNPKAWADQ GYVVVAPNPT
GSTGFGQALTDAIQNNWGGAPYDDLVKCWEYVHENLDYVD
TDHGVAAGASYGGFMINWIQGSPLGRKFKALVSHDGTFV
ADAKVSTEELW FMQREFNGTFWDARDNYRRWDPSAPERI
LQFATPMLVIHSDKDYRLPVAE GLSLFNVLQERGVPSRF
LNFPDENHWVVNPENSLVWHQQALGWINKYSGV EKSNPN
AVSLEDTVVPVVNYN

References

Title : Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus - Fedorova_2008_PLoS.Genet_4_e1000046
Author(s) : Fedorova ND , Khaldi N , Joardar VS , Maiti R , Amedeo P , Anderson MJ , Crabtree J , Silva JC , Badger JH , Albarraq A , Angiuoli S , Bussey H , Bowyer P , Cotty PJ , Dyer PS , Egan A , Galens K , Fraser-Liggett CM , Haas BJ , Inman JM , Kent R , Lemieux S , Malavazi I , Orvis J , Roemer T , Ronning CM , Sundaram JP , Sutton G , Turner G , Venter JC , White OR , Whitty BR , Youngman P , Wolfe KH , Goldman GH , Wortman JR , Jiang B , Denning DW , Nierman WC
Ref : PLoS Genet , 4 :e1000046 , 2008
Abstract : Fedorova_2008_PLoS.Genet_4_e1000046
ESTHER : Fedorova_2008_PLoS.Genet_4_e1000046
PubMedSearch : Fedorova_2008_PLoS.Genet_4_e1000046
PubMedID: 18404212
Gene_locus related to this paper: aspcl-a1c4m6 , aspcl-a1c5a7 , aspcl-a1c6w3 , aspcl-a1c8p7 , aspcl-a1c8q9 , aspcl-a1c9k4 , aspcl-a1c759 , aspcl-a1c786 , aspcl-a1c823 , aspcl-a1c859 , aspcl-a1c881 , aspcl-a1c994 , aspcl-a1cag4 , aspcl-a1caj8 , aspcl-a1cas0 , aspcl-a1cc86 , aspcl-a1ccq2 , aspcl-a1cfv7 , aspcl-a1chj6 , aspcl-a1cif4 , aspcl-a1ck14 , aspcl-a1cke4 , aspcl-a1ckq1 , aspcl-a1cli1 , aspcl-a1cln8 , aspcl-a1cm72 , aspcl-a1cns2 , aspcl-a1cpk9 , aspcl-a1cra8 , aspcl-a1crr5 , aspcl-a1crs9 , aspcl-a1cs04 , aspcl-a1cs39 , aspcl-a1cu39 , aspcl-atg15 , aspcl-axe1 , aspcl-cuti1 , aspcl-cuti3 , aspcl-dapb , aspcl-dpp4 , aspcl-dpp5 , aspcl-faeb , aspcl-faec1 , aspcl-faec2 , aspfc-b0xp50 , aspfc-b0xu40 , aspfc-b0xzj6 , aspfc-b0y2h6 , aspfc-b0y962 , aspfc-b0yaj6 , aspfc-dpp5 , aspfu-DPP4 , aspfu-faeb1 , aspfu-faec , aspfu-ppme1 , aspfu-q4w9r3 , aspfu-q4w9t5 , aspfu-q4w9z4 , aspfu-q4wa57 , aspfu-q4wa78 , aspfu-q4wag0 , aspfu-q4wal3 , aspfu-q4wbc5 , aspfu-q4wbj7 , aspfu-q4wdg2 , aspfu-q4wf06 , aspfu-q4wf29 , aspfu-q4wf56 , aspfu-q4wfq9 , aspfu-q4wg73 , aspfu-q4wgm4 , aspfu-q4win2 , aspfu-q4wk31 , aspfu-q4wk44 , aspfu-q4wk90 , aspfu-q4wm12 , aspfu-q4wm84 , aspfu-q4wm86 , aspfu-q4wmr0 , aspfu-q4wny7 , aspfu-q4wp19 , aspfu-q4wpb9 , aspfu-q4wqj8 , aspfu-q4wqv2 , aspfu-q4wrr7 , aspfu-q4wu51 , aspfu-q4wub2 , aspfu-q4wui7 , aspfu-q4wuk8 , aspfu-q4wum3 , aspfu-q4wuw0 , aspfu-q4wvy1 , aspfu-q4ww22 , aspfu-q4wx13 , aspfu-q4wxd0 , aspfu-q4wxe4 , aspfu-q4wxr1 , aspfu-q4wyq5 , aspfu-q4wz16 , aspfu-q4wzd5 , aspfu-q4wzh6 , aspfu-q4x0n6 , aspfu-q4x1n0 , aspfu-q4x1w9 , aspfu-q4x078 , neofi-a1cwa6 , neofi-a1d4m8 , neofi-a1d4p0 , neofi-a1d5p2 , neofi-a1d104 , neofi-a1d380 , neofi-a1d512 , neofi-a1d654 , neofi-a1da18 , neofi-a1dal8 , neofi-a1df46 , neofi-a1dhj0 , neofi-a1di44 , neofi-a1dk35 , neofi-a1dki7 , neofi-a1dkt6 , neofi-a1dn55 , neofi-atg15 , neofi-axe1 , neofi-faeb1 , neofi-faeb2 , neofi-faec , aspcl-a1cd34 , aspcl-a1cd88 , neofi-a1dc66 , aspcl-a1ceh5 , neofi-a1dfr9 , aspfm-a0a084bf80 , aspcl-a1cqb5 , aspcl-a1cs44 , neofi-a1d517 , neofi-a1dbz0 , neofi-a1cuz0 , aspcl-a1c5e8 , neofi-a1d0b8 , aspcl-a1cdf0 , aspcl-a1ccd3 , neofi-a1da82 , neofi-a1d5e6 , aspcl-kex1 , aspcl-cbpya

Title : Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus - Nierman_2005_Nature_438_1151
Author(s) : Nierman WC , Pain A , Anderson MJ , Wortman JR , Kim HS , Arroyo J , Berriman M , Abe K , Archer DB , Bermejo C , Bennett J , Bowyer P , Chen D , Collins M , Coulsen R , Davies R , Dyer PS , Farman M , Fedorova N , Feldblyum TV , Fischer R , Fosker N , Fraser A , Garcia JL , Garcia MJ , Goble A , Goldman GH , Gomi K , Griffith-Jones S , Gwilliam R , Haas B , Haas H , Harris D , Horiuchi H , Huang J , Humphray S , Jimenez J , Keller N , Khouri H , Kitamoto K , Kobayashi T , Konzack S , Kulkarni R , Kumagai T , Lafon A , Latge JP , Li W , Lord A , Lu C , Majoros WH , May GS , Miller BL , Mohamoud Y , Molina M , Monod M , Mouyna I , Mulligan S , Murphy L , O'Neil S , Paulsen I , Penalva MA , Pertea M , Price C , Pritchard BL , Quail MA , Rabbinowitsch E , Rawlins N , Rajandream MA , Reichard U , Renauld H , Robson GD , Rodriguez de Cordoba S , Rodriguez-Pena JM , Ronning CM , Rutter S , Salzberg SL , Sanchez M , Sanchez-Ferrero JC , Saunders D , Seeger K , Squares R , Squares S , Takeuchi M , Tekaia F , Turner G , Vazquez de Aldana CR , Weidman J , White O , Woodward J , Yu JH , Fraser C , Galagan JE , Asai K , Machida M , Hall N , Barrell B , Denning DW
Ref : Nature , 438 :1151 , 2005
Abstract : Nierman_2005_Nature_438_1151
ESTHER : Nierman_2005_Nature_438_1151
PubMedSearch : Nierman_2005_Nature_438_1151
PubMedID: 16372009
Gene_locus related to this paper: aspfc-b0xp50 , aspfc-b0xu40 , aspfc-b0xzj6 , aspfc-dpp5 , aspfu-apth1 , aspfu-axe1 , aspfu-CBPYA , aspfu-faec , aspfu-kex1 , aspfu-ppme1 , aspfu-q4wa39 , aspfu-q4wa78 , aspfu-q4wf56 , aspfu-q4wg73 , aspfu-q4wk44 , aspfu-q4wkh6 , aspfu-q4wnx3 , aspfu-q4wpb9 , aspfu-q4wqv2 , aspfu-q4wub2 , aspfu-q4wxr1 , aspfu-q4x0n6 , aspfu-q4x1n0 , aspfu-q5vjg7 , neofi-a1cwa6 , neofi-a1dfr9 , aspfm-a0a084bf80 , aspfu-fmac

Title : Biochemical and antigenic characterization of a new dipeptidyl-peptidase isolated from Aspergillus fumigatus - Beauvais_1997_J.Biol.Chem_272_6238
Author(s) : Beauvais A , Monod M , Debeaupuis JP , Diaquin M , Kobayashi H , Latge JP
Ref : Journal of Biological Chemistry , 272 :6238 , 1997
Abstract : Beauvais_1997_J.Biol.Chem_272_6238
ESTHER : Beauvais_1997_J.Biol.Chem_272_6238
PubMedSearch : Beauvais_1997_J.Biol.Chem_272_6238
PubMedID: 9045640
Gene_locus related to this paper: aspfc-dpp5