Gene_locus Report for: aspnc-a2qbx7

Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similar predicted ORFs

Comment

only central part Pfam A DUF726 429 782

Relationship

Family	\|	Duf_726
Block	\|	X
Position in NCBI Life Tree	\|	Aspergillus niger

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus niger: N E

There are 168 a/b hydrolases in Aspergillus niger view in a: Table

6_AlphaBeta_hydrolase : aspnc-a2qbd3Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein SC4B10.33 - Streptomyces coelicolor, aspnc-a2qdj6Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein F17H10.1 -Caenorhabditis elegans, aspnc-a2qh52Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein mll2018 - Mesorhizobium loti, aspnc-a2qib2Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An04g02910, aspnc-a2qlz0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An07g00200, aspnc-a2qnw9Aspergillus niger (strain CBS 513.88 / FGSC A1513) Function: R. opacus pcaL is involved in the degradation of aromatic compounds, aspnc-a2qwz6Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An11g07020, aspnc-a2r0u0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to alkyl salicylate esterase salE - Acinetobacter sp., aspnc-a2r1p3Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: 3-Oxoadipate enol-lactone + H2O = 3-Oxoadipate, aspnc-a2r6g3Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to alkyl salicylate esterase salE - Acinetobacter sp., aspnc-a2r9y8Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical esterase SCD10.24 - Streptomyces coelicolor, aspnc-a2r032Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An12g07180, aspnc-a2r040Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein SC4B10.22 - Streptomyces coelicolor, aspnc-a2ra07Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An18g00910, aspnc-a2rap4Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An18g03880, aspnc-a2rav1Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: an epoxide + H(2)O <=> a glycol, aspnc-a5aaf4Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity: similarity to esterases and lipases, aspnc-a5ab63Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An08g09180, aspnc-a5abf0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An11g00150, aspnc-a5abt2Aspergillus niger (strain CBS 513.88 / FGSC A1513) Contig An11c0340, complete genome.
A85-EsteraseD-FGH : aspnc-a2qms0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An07g03100.
A85-Feruloyl-Esterase : aspnc-a2r6h8Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An16g00060.
ABHD11-Acetyl_transferase : aspna-g3xsl3Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7). Uncharacterized protein.
ABHD13-BEM46 : aspna-g3xpw9Aspergillus niger; Aspergillus brasiliensis; Aspergillus welwitschiae; Aspergillus eucalypticola; Aspergillus tubingensis; Aspergillus lacticoffeatus. Catalytic protein.
abh_upf0017 : aspnc-a2r4j8Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An15g00670.
Acetylxylan_esterase : aspnc-a2qt47Aspergillus niger Aspergillus kawachii,Catalytic activity: axe1 cleaves acetyl side chain groups from acetyl xylan, aspnc-a2qt66Aspergillus niger Catalytic activity: deacetylation of xylans and xylo-oligosaccharides AnCE5.
Acidic_Lipase : aspnc-a2qn29Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: triacylglycerol + H2O = diacylglycerol + a fatty acid anion, aspnc-a5abz1Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An15g03950.
Arb2_domain : aspna-g3y5a6Aspergillus niger; Aspergillus brasiliensis; A. neoniger; A. kawachii; A. luchuensis; A. vadensis; A. tubingensis; A. eucalypticola; A. welwitschiae; A. phoenicis; A. lacticoffeatus; A. luchuensis; A. awamori. Histone deacetylase Arb2 domain.
Bacterial_esterase : aspnc-a2ql23Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An05g02280.
BD-FAE : aspnc-a2qzx0Aspergillus niger Putative uncharacterized protein (EC 3.1.1.1), aspng-a2qzk9Aspergillus niger (EC 3.1.1.-).
Canar_LipB : aspna-g3xpq9Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSH Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) Uncharacterized protein, aspnc-a2r199Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An13g00480.
Carboxypeptidase_S10 : aspna-g3y4g9Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSH Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) Uncharacterized protein, aspng-pepfAspergillus niger pepF gene, aspsa-pepsAspergillus saitoi and Aspergillus niger carboxypeptidase, aspnc-kex1Aspergillus niger (strain CBS 513.88 / FGSC A1513). Carboxypeptidase D, aspnc-cbpyaAspergillus niger (strain CBS 513.88 / FGSC A1513). Carboxypeptidase Y homolog A.
CFTR-inhibitory-factor_Cif : aspnc-a2qh85Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: cEH of C. sp. acts on epoxides.
CGI-58_ABHD5_ABHD4 : aspnc-a2q814Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An01g02690.
Cutinase : aspnc-cuti1Aspergillus niger Cut1 Cutinase Cutin hydrolase 1, aspnc-cuti2Aspergillus niger, Aspergillus kawachii, Cut2, Cutinase Cutin hydrolase 2.
DPP4N_Peptidase_S9 : aspng-DAPBAspergillus niger dipeptidyl aminopeptidase type IV (EC 3.4.14.5).
Duf_726 : aspnc-a2raq2Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein YFL034w - Saccharomyces cerevisiae.
Duf_829 : aspng-a2q8w0Aspergillus niger Contig An01c0200, complete genome, aspng-a2r0p8Aspergillus niger Similarity to hypothetical protein PaxU -Penicillium paxilli, aspng-a2r225Aspergillus niger Contig An13c0090, complete genome.
Duf_900 : aspnc-a5abc6Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein encoded by An02g10630 - Aspergillus niger.
Duf_1100-S : aspnc-a2r3s8Aspergillus niger (strain CBS 513.88 / FGSC A1513) Function: ayg1 of A. fumigatus has an unknown function.
Duf_2235 : aspnc-a2qbp6Aspergillus niger (strain CBS 513.88 / FGSC A1513). Similarity to hypothetical protein PA2063 - Pseudomonas aeruginosa.
Epoxide_hydrolase : aspnc-a2qb93Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: an epoxide + H(2)O <=> a glycol, aspnc-a2qk14Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An04g09000, aspnc-a2qn70Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: epoxide hydrolases convert an epoxide + H(2)O to a glycol, aspng-q1ktb6Aspergillus niger epoxide hydrolase (EC 3.3.2.3), aspng-q1ktb5

Aspergillus usamii; Aspergillus niger; Aspergillus lacticoffeatus; Aspergillus brasiliensis AuEH2 Microsomal epoxide hyddrolase (EC 3.3.2.3), aspni-hyl1

Aspergillus niger hyl1 gene, exons 1-9.
Esterase_phb : aspnc-axe1Aspergillus niger; Aspergillus ficuum Porbable acetylxylan esterase A, aspng-a0a100iph2Aspergillus niger; Aspergillus tubingensis. Acetylxylan esterase A.
FaeC : aspnc-faecAspergillus niger; A. lacticoffeatus; A. phoenicis; A. welwitschiae; A. awamori; A. brasiliensis Ferulic acid esterase SF5-CC AnFaeC.
FSH1 : aspna-azacAspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7). Azaphilone biosynthesis cluster protein azaC.
Fungal-Bact_LIP : aspnc-a2qm14Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: triacylglycerol + H2O = diacylglycerol + a carboxylate.
Fungal_carboxylesterase_lipase : aspna-g3yal2Aspergillus niger Aspergillus kawachii Putative uncharacterized protein An03g06630 Carboxylesterase (EC 3.1.1.3), aspna-g3ycq2Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSH Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) Carboxylesterase, aspnc-a2qbh3Aspergillus niger Carboxylesterase (EC 3.1.1.-), aspnc-a2qe77Aspergillus niger Aspergillus kawachii Carboxyesterase (EC 3.1.1.3), aspnc-a2qf54Aspergillus niger Aspergillus kawachii Carboxylesterase precursor (EC 3.1.1.-), aspnc-a2qfe9Aspergillus niger Aspergillus kawachii Carboxylesterase precursor (EC 3.1.1.41), aspnc-a2qg33Aspergillus niger Carboxylesterase (EC 3.1.1.-), aspnc-a2qh76Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2qhe2Aspergillus niger Aspergillus kawachii; Aspergillus luchuensis Putative uncharacterized protein (EC 3.1.1.3), aspnc-a2qi32Aspergillus niger Aspergillus kawachii Carboxylesterase Putative uncharacterized protein An04g02100, aspnc-a2ql89Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.1), aspnc-a2ql90Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.3) Putative uncharacterized protein An06g00350, aspnc-a2qla0Aspergillus niger; Aspergillus kawachii; Aspergillus luchuensis Putative uncharacterized protein An06g00460 Carboxylesterase (EC 3.1.1.8), aspnc-a2qmk5Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.1), aspnc-a2qn56Aspergillus niger Aspergillus kawachii Chlorogenic acid esterase Putative uncharacterized protein An07g04470 Carboxylesterase, aspnc-a2qs22Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2qti9Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.3), aspnc-a2qtz0Aspergillus niger Aspergillus kawachii Catalytic activity:Triacylglycerol + H2O = Diacylglycerol + a carboxylate (EC 3.1.1.3), aspnc-a2quc1Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.3), aspnc-a2qx92Aspergillus niger, Aspergillus kawachii precursor (EC 3.1.1.7), aspnc-a2qyf0Aspergillus niger Aspergillus kawachii Carboxylesterase, aspnc-a2qys7Aspergillus niger Aspergillus kawachii; Aspergillus luchuensis Carboxylesterase (EC 3.1.1.-), aspnc-a2qz72Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2qzn6Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2qzr0Aspergillus niger Aspergillus kawachii putative Carboxylesterase (EC 3.1.1.1), aspnc-a2qzx4Aspergillus niger carboxylate precursor (EC 3.1.1.3), aspnc-a2r0p4Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2r1r5Aspergillus niger Carboxylesterase (EC 3.1.1.1), aspnc-a2r2i5Aspergillus niger Aspergillus kawachii; Aspergillus luchuensis Carboxylesterase (EC 3.1.1.3), aspnc-a2r5r4Aspergillus niger Aspergillus kawachii Putative uncharacterized protein (EC 3.1.1.1), aspnc-a2r6h5Aspergillus niger catalytic activity: esterase 2 (EC 3.1.-.-), aspnc-a2r8r3Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2r8z3Aspergillus niger Aspergillus kawachii precursor (EC 3.1.1.3), aspnc-a2r273Aspergillus niger; Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2r496Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2r502Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.3), aspnc-a5abe5Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a5abe8Aspergillus niger Aspergillus kawachii similar to pnb Carboxylesterase(EC 3.1.1.-), aspnc-a5abh9Aspergillus niger Aspergillus kawachii Carboxylesterase(EC 3.1.1.-), aspnc-a5abk1Aspergillus niger Aspergillus kawachii contig an11c0010, complete genome. (EC 3.1.1.-), aspng-a2qs46Aspergillus niger Catalytic activity: Triacylglycerol + H2O = Diacylglycerol + a carboxylate precursor (EC 3.1.1.3) (ec 3.1.1.41), aspng-a2qst4Aspergillus niger Aspergillus kawachii Catalytic activity: cephalosporin C + H2O = deacetylcephalosporin C + acetate precursor (EC 3.1.1.41), aspng-a2qv27Aspergillus niger Carboxylesterase (EC 3.1.1.-), aspni-EstA

Aspergillus niger Aspergillus kawachii Carboxylesterase EstA (EC 3.1.1.3) (ec 3.1.1.41), aspng-a0a100i841Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100i860Aspergillus niger; Aspergillus luchuensis, EstA, aspng-a0a100ie01Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100ieg8Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100ifw6Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a100ig15Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a100ig19Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a100iin7Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a100iip6Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100ijp7Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100iks1Aspergillus niger; Aspergillus luchuensis, Acetylcholinesterase, aspng-a0a100ils5Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100im87Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100imq6Aspergillus niger, Lipase, aspng-a0a100ipx4Aspergillus niger, Pc21g22430, aspng-a0a100ipy0Aspergillus niger, Carboxylesterase, aspng-a0a100iq47Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a100iqq3Aspergillus niger, Carboxylesterase, aspng-a0a100iu10Aspergillus niger, Carboxylesterase, aspng-a0a117dx77Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a117dz65Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a117e043Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a117e0s5Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a117e335Aspergillus niger, Carboxylesterase, aspng-a0a117e396Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a117e3u0Aspergillus niger, Carboxylesterase family protein, aspng-a0a124by93Aspergillus niger, Carboxylesterase, aspng-a0a124byn7Aspergillus niger, Carboxylic ester hydrolase.
Fusarinine_C_esterase_sidJ : aspnc-a2qgj6Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity: the ORF shows strong similarity to the A. niger protein An16g04320, aspnc-a2r7q1Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An16g04320.
Haloalkane_dehalogenase-HLD1 : aspnc-a2r4c0Aspergillus nige Catalytic Epoxide hydrolase.
Haloperoxidase : aspnc-a2qt50Aspergillus niger (strain CBS 513.88 / FGSC A1513) Contig An09c0040, complete genome.
Kynurenine-formamidase : aspnc-a2qqa1Aspergillus niger N-formylkynurenine formamidase, aspng-a0a117e0n8Aspergillus niger, Kynurenine formamidase, KFA, KFase, Arylformamidase, N-formylkynurenine formamidase, FKF.
LIDHydrolase : aspnc-a2qgm6Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical membrane protein YPR147c - Saccharomyces cerevisiae.
Lipase_3 : aspng-EXANL1Aspergillus niger sn-1, 3 Extracellular lipase EXANL1 PEXANL1, aspnc-atg15Aspergillus niger (strain CBS 513.88 / FGSC A1513) Autophagy-related protein 15, aspni-FAEA

Aspergillus niger; A. usamii; A. phoenicis ; A. awamori; A. welwitschiae; A. vadensis; A. lacticoffeatus; A. phoenicis ferulic acid esterase a; SF7 A; AnFAEA AnFae1.
Monoglyceridelipase_lysophospholip : aspnc-a2qw06Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An11g03380.
MpaH : aspnc-a2qw57Aspergillus niger; Aspergillus awamori (Black koji mold); Aspergillus welwitschiae. Aspergillus niger contig An11c0150, genomic contig, aspng-a0a100iew6Aspergillus niger. Toxin biosynthesis protein.
PAF-Acetylhydrolase : aspnc-a2qt70Aspergillus niger (strain CBS 513.88 / FGSC A1513). Aspergillus niger contig An09c0040, genomic contig.
PMH_Peptidase_S9 : aspni-APSCAspergillus niger aminopeptidase c, Putative uncharacterized protein An04g02850.
PPase_methylesterase_euk : aspnc-a2q8r7Aspergillus niger (strain CBS 513.88 / FGSC A1513) Protein phosphatase methylesterase 1.
Proline_iminopeptidase : aspni-PAPAAspergillus niger prolyl aminopeptidase a (EC 3.4.11.5), aspnc-a2r871Aspergillus niger (strain CBS 513.88 / FGSC A1513). Function: PIP of B. coagulans has a higher activity toward small peptides.
Prolylcarboxypeptidase : aspnc-a2qr21

Aspergillus niger (strain CBS 513.88 / FGSC A1513) Endoprotease Endo-Pro-Aspergillus niger, aspnc-a2qzs1Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An12g05960, aspnc-a2r2l0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An14g01120.
Prolyl_oligopeptidase_S9 : aspng-DPP5Aspergillus niger, dipeptidyl peptidase V.
Tannase : aspng-AnFaeJAspergillus niger Carboxylic ester hydrolase feruloyl esterase SF9 AnFaeJ, aspnc-a2qir3

Aspergillus niger Carboxylic ester hydrolase Tannase An04g04430 An-Tan, aspng-faebAspergillus niger (and strain CBS 513.88 / FGSC A1513) SF1-B (faeb) (fae-i) (cinnamoyl esterase) (cinnae) AnFaeB, aspng-q3s2a9Aspergillus niger tannase (fragment), aspnc-a2r9c0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Carboxylic ester hydrolase, aspng-a0a124bxs8.2Aspergillus niger, Tannase, aspnc-a2qbg8Aspergillus niger (strain CBS 513.88 / FGSC A1513). Carboxylic ester hydrolase.
Thioesterase : aspnc-pyniAspergillus niger (strain CBS 513.88 / FGSC A1513). Pyranonigrin biosynthesis cluster protein I, aspna-albaAspergillus niger. Non-reducing polyketide synthase albA. Thioesterase last domain.
Thiohydrolase : aspng-a0a100i8t9Aspergillus niger; Aspergillus tubingensis. AB hydrolase-1 domain-containing protein

Molecular evidence		Database
No mutation No structure No kinetic No Substrate No inhibitor		1 Genbank : AM269996 1 UniProt : A2QBX7 1 UniProt : A2QBX7 1 Interpro : A2QBX7 1 Pfam : A2QBX7 1 PIRSF : A2QBX7 1 SUPERFAM : A2QBX7

Sequence

Peptide

Graphical view for this peptide sequence: aspnc-a2qbx7
Colored MSA for Duf_726 (raw)
VAGAALIGITGGLAAPLVAAGLGTVLGGLGLGATAAAGYLGALAGSGVIV GGLFGAYGGRMTGRMVDKYAREVDDFAFLPIRGSRQRSEDEREAAQNDHM LRVTIGITGWVTEEDNFVVPWRVIGADSEVFGLRWETEPLMKLGNAMNLL VTSAAWAAGGQVLSRTIFAQIMSAVMLPLGLLKVARVADNPFSIAKARAD KAGEVLADALISKVQGERAVTLIGYSMGSRVIFSCLQSLAKRGAYDLVES AILMGSPTPSNAPHWRRLRSVVSGRLINVYSENDAVLALLYRTSSLQLGV AGLQSVQDVPGVENLDVSETVSGHLRYQFLIGRILGLVG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
VAGAALIGITGGLAAPLVAAGLGTVLGGLGLGATAAAGYLGALAGSGVIV
GGLFGAYGGRMTGRMVDKYAREVDDFAFLPIRGSRQRSEDEREAAQNDHM
LRVTIGITGWVTEEDNFVVPWRVIGADSEVFGLRWETEPLMKLGNAMNLL
VTSAAWAAGGQVLSRTIFAQIMSAVMLPLGLLKVARVADNPFSIAKARAD
KAGEVLADALISKVQGERAVTLIGYSMGSRVIFSCLQSLAKRGAYDLVES
AILMGSPTPSNAPHWRRLRSVVSGRLINVYSENDAVLALLYRTSSLQLGV
AGLQSVQDVPGVENLDVSETVSGHLRYQFLIGRILGLVG

Reference

Title:

Pel HJ, de Winde JH, Archer DB, Dyer PS, Hofmann G, Schaap PJ, Turner G, de Vries RP, Albang R and Stam H <59 more author(s)>

Ref:

PubMed

Other Papers

Send your questions or comments to :Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.

For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page

webmaster

Acknowledgements and disclaimer