Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspng-faeb

Aspergillus niger (and strain CBS 513.88 / FGSC A1513) SF1-B (faeb) (fae-i) (cinnamoyl esterase) (cinnae) AnFaeB

Relationship
Family|Tannase
Block| X
Position in NCBI Life Tree|Aspergillus niger
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus niger: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





5 substrates (e.g. : Ara3F, FA-AraXyl2, Ferulic-acid... more)
No inhibitor
3 Genbank : AJ309807, AM270291, CAC83933
2 UniProt : Q8WZI8, A2R0Z6
2 UniProt : Q8WZI8, A2R0Z6
2 Interpro : Q8WZI8, A2R0Z6
2 Pfam : Q8WZI8, A2R0Z6
2 PIRSF : Q8WZI8, A2R0Z6
2 SUPERFAM : Q8WZI8, A2R0Z6
Sequence
Graphical view for this peptide sequence: aspng-faeb
Colored MSA for Tannase (raw)
MKVASLLSLALPGAALAATDPFQSRCNEFQNKIDIANVTVRSVAYVAAGQ
NISQAEVASVCKASVQASVDLCRVTMNISTSDRSHLWAEAWLPRNYTGRF
VSTGNGGLAGCVQETDLNFAANFGFATVGTNGGHDGDTAKYFLNNSEVLA
DFAYRSVHEGTVVGKQLTQLFYDEGYNYSYYLGCSTGGRQGYQQVQRFPD
DYDGVIAGSAAMNFINLISWGAFLWKATGLADDPDFISANLWSVIHQEIV
RQCDLVDGALDGIIEDPDFCAPVIERLICDGTTNGTSCITGAQAAKVNRA
LSDFYGPDGTVYYPRLNYGGEADSASLYFTGSMYSRTEEWYKYVVYNDTN
WNSSQWTLESAKLALEQNPFNIQAFDPNITAFRDRGGKLLSYHGTQDPII
SSTDSKLYYRRVANALNAAPSELDEFYRFFQISGMGHCGDGTGASYIGQG
YGTYTSKAPQVNLLRTMVDWVENGKAPEYMPGNKLNANGSIEYMRKHCRY
PKHNIHTGPGNYTDPNSWTCV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVASLLSLALPGAALAATDPFQSRCNEFQNKIDIANVTVRSVAYVAAGQ
NISQAEVASVCKASVQASVDLCRVTMNISTSDRSHLWAEAWLPRNYTGRF
VSTGNGGLAGCVQETDLNFAANFGFATVGTNGGHDGDTAKYFLNNSEVLA
DFAYRSVHEGTVVGKQLTQLFYDEGYNYSYYLGCSTGGRQGYQQVQRFPD
DYDGVIAGSAAMNFINLISWGAFLWKATGLADDPDFISANLWSVIHQEIV
RQCDLVDGALDGIIEDPDFCAPVIERLICDGTTNGTSCITGAQAAKVNRA
LSDFYGPDGTVYYPRLNYGGEADSASLYFTGSMYSRTEEWYKYVVYNDTN
WNSSQWTLESAKLALEQNPFNIQAFDPNITAFRDRGGKLLSYHGTQDPII
SSTDSKLYYRRVANALNAAPSELDEFYRFFQISGMGHCGDGTGASYIGQG
YGTYTSKAPQVNLLRTMVDWVENGKAPEYMPGNKLNANGSIEYMRKHCRY
PKHNIHTGPGNYTDPNSWTCV


References
4 more
    Title: Utilization of ferulic acid in Aspergillus niger requires the transcription factor FarA and a newly identified Far-like protein (FarD) that lacks the canonical Zn(II)(2)Cys(6) domain
    Arentshorst M, Reijngoud J, van Tol DJC, Reid ID, Arendsen Y, Pel HJ, van Peij N, Visser J, Punt PJ and Ram AFJ <1 more author(s)>
    Ref: Front Fungal Biol, 3:978845, 2022 : PubMed

            

    Title: Homologous expression of the feruloyl esterase B gene from Aspergillus niger and characterization of the recombinant enzyme
    Levasseur A, Benoit I, Asther M, Record E
    Ref: Protein Expr Purif, 37:126, 2004 : PubMed

            

    Title: The Aspergillus niger faeB gene encodes a second feruloyl esterase involved in pectin and xylan degradation and is specifically induced in the presence of aromatic compounds
    de Vries RP, vanKuyk PA, Kester HC, Visser J
    Ref: Biochemical Journal, 363:377, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer