Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspng-faeb

Aspergillus niger (and strain CBS 513.88 / FGSC A1513) (faeb) (fae-i) (cinnamoyl esterase) (cinnae)

Relationship
Family|Tannase
Block| X
Position in NCBI Life Tree|Aspergillus niger
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus niger: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AJ309807, AM270291
2 UniProt : Q8WZI8, A2R0Z6
2 UniProt : Q8WZI8, A2R0Z6
2 Interpro : Q8WZI8, A2R0Z6
2 Pfam : Q8WZI8, A2R0Z6
2 PIRSF : Q8WZI8, A2R0Z6
2 SUPERFAM : Q8WZI8, A2R0Z6
Sequence
Graphical view for this peptide sequence: aspng-faeb
Colored MSA for Tannase (raw)
MKVASLLSLALPGAALAATDPFQSRCNEFQNKIDIANVTVRSVAYVAAGQ
NISQAEVASVCKASVQASVDLCRVTMNISTSDRSHLWAEAWLPRNYTGRF
VSTGNGGLAGCVQETDLNFAANFGFATVGTNGGHDGDTAKYFLNNSEVLA
DFAYRSVHEGTVVGKQLTQLFYDEGYNYSYYLGCSTGGRQGYQQVQRFPD
DYDGVIAGSAAMNFINLISWGAFLWKATGLADDPDFISANLWSVIHQEIV
RQCDLVDGALDGIIEDPDFCAPVIERLICDGTTNGTSCITGAQAAKVNRA
LSDFYGPDGTVYYPRLNYGGEADSASLYFTGSMYSRTEEWYKYVVYNDTN
WNSSQWTLESAKLALEQNPFNIQAFDPNITAFRDRGGKLLSYHGTQDPII
SSTDSKLYYRRVANALNAAPSELDEFYRFFQISGMGHCGDGTGASYIGQG
YGTYTSKAPQVNLLRTMVDWVENGKAPEYMPGNKLNANGSIEYMRKHCRY
PKHNIHTGPGNYTDPNSWTCV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKVASLLSLALPGAALAATDPFQSRCNEFQNKIDIANVTVRSVAYVAAGQ
NISQAEVASVCKASVQASVDLCRVTMNISTSDRSHLWAEAWLPRNYTGRF
VSTGNGGLAGCVQETDLNFAANFGFATVGTNGGHDGDTAKYFLNNSEVLA
DFAYRSVHEGTVVGKQLTQLFYDEGYNYSYYLGCSTGGRQGYQQVQRFPD
DYDGVIAGSAAMNFINLISWGAFLWKATGLADDPDFISANLWSVIHQEIV
RQCDLVDGALDGIIEDPDFCAPVIERLICDGTTNGTSCITGAQAAKVNRA
LSDFYGPDGTVYYPRLNYGGEADSASLYFTGSMYSRTEEWYKYVVYNDTN
WNSSQWTLESAKLALEQNPFNIQAFDPNITAFRDRGGKLLSYHGTQDPII
SSTDSKLYYRRVANALNAAPSELDEFYRFFQISGMGHCGDGTGASYIGQG
YGTYTSKAPQVNLLRTMVDWVENGKAPEYMPGNKLNANGSIEYMRKHCRY
PKHNIHTGPGNYTDPNSWTCV


References
2 more
    Title: The Aspergillus niger faeB gene encodes a second feruloyl esterase involved in pectin and xylan degradation and is specifically induced in the presence of aromatic compounds
    de Vries RP, vanKuyk PA, Kester HC, Visser J
    Ref: Biochemical Journal, 363:377, 2002 : PubMed

            

    Title: Purification and characterization of a novel esterase induced by growth of Aspergillus niger on sugar-beet pulp
    Kroon PA, Faulds CB, Williamson G
    Ref: Biotechnol Appl Biochem, 23 ( Pt 3):255, 1996 : PubMed

            

    Title: Degradation of feruloylated oligosaccharides from sugar-beet pulp and wheat bran by ferulic acid esterases from Aspergillus niger
    Ralet MC, Faulds CB, Williamson G, Thibault JF
    Ref: Carbohydr Res, 263:257, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer