Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brafl-c3y2t9

Branchiostoma floridae (Florida lancelet) (Amphioxus). Uncharacterized protein

Relationship
Family|Pancreatic_lipase
Block| L
Position in NCBI Life Tree|Branchiostoma floridae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Cephalochordata: N E > Branchiostomidae: N E > Branchiostoma: N E > Branchiostoma floridae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : GG666482, XP_002609341
1 UniProt : C3Y2T9
1 UniProt : C3Y2T9
1 Interpro : C3Y2T9
1 Prodom : C3Y2T9
1 Pfam : C3Y2T9
1 PIRSF : C3Y2T9
1 SUPERFAM : C3Y2T9
Sequence
Graphical view for this peptide sequence: brafl-c3y2t9
Colored MSA for Pancreatic_lipase (raw)
GARVCYWDLGCFTDEPPYPERLPQPPEALNVQFLLYTRHNMDDPQTLTVW
DIEGTETSHFNRTADTKVIIHGFIDDTDVEWLINMKDAILYREDANVILV
DWAGGSKTLDYTQAAADTRVVGSEVARFIIFIKYLKDYPEERFHLIGHSL
GSHIAGQAGKLWKGIGRITGLDPAYPFFEGKPPEVRLDPTDAIFVDAIHT
DGDANHKLAGFGMMDPVGHLDFYPNGGMDQPGCGESLFEYVRDQGVWGGG
ETFVVCNHLRAVILFIDSINSDCSWRAYPCSDYQTFVDGNCMTCGDAGCY
SMGYDAD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GARVCYWDLGCFTDEPPYPERLPQPPEALNVQFLLYTRHNMDDPQTLTVW
DIEGTETSHFNRTADTKVIIHGFIDDTDVEWLINMKDAILYREDANVILV
DWAGGSKTLDYTQAAADTRVVGSEVARFIIFIKYLKDYPEERFHLIGHSL
GSHIAGQAGKLWKGIGRITGLDPAYPFFEGKPPEVRLDPTDAIFVDAIHT
DGDANHKLAGFGMMDPVGHLDFYPNGGMDQPGCGESLFEYVRDQGVWGGG
ETFVVCNHLRAVILFIDSINSDCSWRAYPCSDYQTFVDGNCMTCGDAGCY
SMGYDAD


Reference
    Title: The amphioxus genome and the evolution of the chordate karyotype
    Putnam NH, Butts T, Ferrier DE, Furlong RF, Hellsten U, Kawashima T, Robinson-Rechavi M, Shoguchi E, Terry A and Rokhsar DS <27 more author(s)>
    Ref: Nature, 453:1064, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer