Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brafl-c3zf44

Branchiostoma floridae (Florida lancelet) (Amphioxus) Putative uncharacterized protein

Comment
gene 171050 C3ZF46 (oldB6LI83) and C3ZF45 206538 (old B6LI84) are repeat of the begining of sequence of 70885 C3ZF44 (old B6LI85)


Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Branchiostoma floridae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Cephalochordata: N E > Branchiostomidae: N E > Branchiostoma: N E > Branchiostoma floridae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : GG666612, DS986818
3 UniProt : C3ZF44, C3ZF45, C3ZF46
3 UniProt : C3ZF44, C3ZF45, C3ZF46
3 Interpro : C3ZF44, C3ZF45, C3ZF46
3 Prodom : C3ZF44, C3ZF45, C3ZF46
3 Pfam : C3ZF44, C3ZF45, C3ZF46
3 PIRSF : C3ZF44, C3ZF45, C3ZF46
3 SUPERFAM : C3ZF44, C3ZF45, C3ZF46
>3 JGI Amphioxus gene links 2 more: 70885, 206538, 171050
Sequence
Graphical view for this peptide sequence: brafl-c3zf44
Colored MSA for Neuroligin (raw)
MDSMWVTSAVLTWILMTASADSNSGEVITTKYGSFRGRQVPPPKDRMRAV
NKYLGIPYAKPPVGNLRFRPPQEPEAWDKGKVRDFTKFGPVCPQIVASGD
TDLPSAVQTREAMRPFLQTMDEDCLYLNIYSPVINGPALDERYPLAVLVF
IHGGGYTTGTGNAYDGTVLASHGSVVVVTINYRLGVLGFLSMEDKFASGN
YGLLDQISALDWISENIRHFGGDPTRVTLVGFGAGAACVNLLALSPKAAG
KFRRAIIQSGSALGTGAITEDSRHYATMLAEKLDCCRPDAAQTVQCLRNK
PYQELLLKNMTPPSSSYYAMFGPSVDGVVVPDQPRRLLEGDLFRSYDFMV
GLSEEDGYKYIPSIAVIENGLSDDDYRNLISDFVNQVFPYRENEIQDAIL
FLYTNWGNDTNETRRAGVVRMLTEQQIAVPIVEVANLHSTKNTESSTYMY
SYSYKAINTPNPKWVGAVHGDELPFMFGAPVAPRGIFQQLNFTKGESMLS
VAMMTYWSNFAKTGDPQQPRVQATTFLHERPNKFENIQWTQYSIDNCSNC
QETYLYLGMKPRVVEGFRPQRIAFWIELVPKLLYPQEVPSNNYLYPPEDA
DELCQILDIGQTILTGGGLAVRRPDGWTKPSVGVTGSSTTCISILPTSAS
PSQFPGNSVPGLTGEWQPESTGSNVSSQEKGQNYSELSIVIAVGTSLLVV
NVIVFAVCYKRGRARTKRHKETETRERIRLKVTDVREVLKAYEIAESCGS
SPCQTLEIIALKDERIENCAKFQEKGDIL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDSMWVTSAVLTWILMTASADSNSGEVITTKYGSFRGRQVPPPKDRMRAV
NKYLGIPYAKPPVGNLRFRPPQEPEAWDKGKVRDFTKFGPVCPQIVASGD
TDLPSAVQTREAMRPFLQTMDEDCLYLNIYSPVINGPALDERYPLAVLVF
IHGGGYTTGTGNAYDGTVLASHGSVVVVTINYRLGVLGFLSMEDKFASGN
YGLLDQISALDWISENIRHFGGDPTRVTLVGFGAGAACVNLLALSPKAAG
KFRRAIIQSGSALGTGAITEDSRHYATMLAEKLDCCRPDAAQTVQCLRNK
PYQELLLKNMTPPSSSYYAMFGPSVDGVVVPDQPRRLLEGDLFRSYDFMV
GLSEEDGYKYIPSIAVIENGLSDDDYRNLISDFVNQVFPYRENEIQDAIL
FLYTNWGNDTNETRRAGVVRMLTEQQIAVPIVEVANLHSTKNTESSTYMY
SYSYKAINTPNPKWVGAVHGDELPFMFGAPVAPRGIFQQLNFTKGESMLS
VAMMTYWSNFAKTGDPQQPRVQATTFLHERPNKFENIQWTQYSIDNCSNC
QETYLYLGMKPRVVEGFRPQRIAFWIELVPKLLYPQEVPSNNYLYPPEDA
DELCQILDIGQTILTGGGLAVRRPDGWTKPSVGVTGSSTTCISILPTSAS
PSQFPGNSVPGLTGEWQPESTGSNVSSQEKGQNYSELSIVIAVGTSLLVV
NVIVFAVCYKRGRARTKRHKETETRERIRLKVTDVREVLKAYEIAESCGS
SPCQTLEIIALKDERIENCAKFQEKGDIL


Reference
    Title: The amphioxus genome and the evolution of the chordate karyotype
    Putnam NH, Butts T, Ferrier DE, Furlong RF, Hellsten U, Kawashima T, Robinson-Rechavi M, Shoguchi E, Terry A and Rokhsar DS <27 more author(s)>
    Ref: Nature, 453:1064, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer