Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brafl-c3zmv1

Branchiostoma floridae (Florida lancelet) (Amphioxus) Putative uncharacterized protein

Comment
probably two genes concataned. 7-TM rhodopsin R and Carboxylesterase. no EST yet. W84 present may be pseudogene Here only c-term. in contig with C3zmv2 head to head


Relationship
Family|Cholinesterase-like
Block| C
Position in NCBI Life Tree|Branchiostoma floridae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Cephalochordata: N E > Branchiostomidae: N E > Branchiostoma: N E > Branchiostoma floridae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: GG666648, DS986813, XM_002590034
1 UniProt : C3ZMV1
1 Ncbi-nid : 260790096
1 Ncbi-pid : 260790097
1 UniProt : C3ZMV1
1 Interpro : C3ZMV1
1 Prodom : C3ZMV1
1 Pfam : C3ZMV1
1 PIRSF : C3ZMV1
1 SUPERFAM : C3ZMV1
2 JGI Amphioxus gene : 83350, 83326
Sequence
Graphical view for this peptide sequence: brafl-c3zmv1
Colored MSA for Cholinesterase-like (raw)
MEPWDGIYNATRKPSACVQDLAFYGREDSIYSTWTPNGPISEDCLYLNVW
QPTPVPTGAAVLVWIYGGSFQVGSSTLDLYDGKHLAAAERVVVVTVNYRV
STLGFLYAGTEGAPGNVGLTDQAMALKWVTQNIASFGGDPSLVTLFGESA
GGISIGYLQMSSDSRDLFHRSIVQSGAMTMPFGRDSASAAYNKTVRFAGS
VGCPSDKGADAIIACLMDKDGRHLVDTSVLGDISFFPVIDGSFLIENPAD
ALKDGNFKSADLLIGSNTNEGPLFWTEDLPEFSSNTNSIITKEQFIKAIQ
FYFPRLNEFAVDAAVYQYTAWGHQEEEAMYRDAFDLLYGDLFAFCPDVIT
ARAHVKQGAATYMYEFSHRASSSAWPDWMGVVHGAEMEFVFGWPQDAALG
YTAEEVELSRRIMRNWANFARTGNPNNNNEATWGAFNQTDGGYTVLDTHA
PRMKTGPRFASCDFWESYVKPLMAKTDALMKGQSCDPATQSDARADNKTA
FWLLSLSLSNLIATYFFTLYS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEPWDGIYNATRKPSACVQDLAFYGREDSIYSTWTPNGPISEDCLYLNVW
QPTPVPTGAAVLVWIYGGSFQVGSSTLDLYDGKHLAAAERVVVVTVNYRV
STLGFLYAGTEGAPGNVGLTDQAMALKWVTQNIASFGGDPSLVTLFGESA
GGISIGYLQMSSDSRDLFHRSIVQSGAMTMPFGRDSASAAYNKTVRFAGS
VGCPSDKGADAIIACLMDKDGRHLVDTSVLGDISFFPVIDGSFLIENPAD
ALKDGNFKSADLLIGSNTNEGPLFWTEDLPEFSSNTNSIITKEQFIKAIQ
FYFPRLNEFAVDAAVYQYTAWGHQEEEAMYRDAFDLLYGDLFAFCPDVIT
ARAHVKQGAATYMYEFSHRASSSAWPDWMGVVHGAEMEFVFGWPQDAALG
YTAEEVELSRRIMRNWANFARTGNPNNNNEATWGAFNQTDGGYTVLDTHA
PRMKTGPRFASCDFWESYVKPLMAKTDALMKGQSCDPATQSDARADNKTA
FWLLSLSLSNLIATYFFTLYS


Reference
    Title: The amphioxus genome and the evolution of the chordate karyotype
    Putnam NH, Butts T, Ferrier DE, Furlong RF, Hellsten U, Kawashima T, Robinson-Rechavi M, Shoguchi E, Terry A and Rokhsar DS <27 more author(s)>
    Ref: Nature, 453:1064, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer