Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: brusu-BRA0989

Brucella suis; B. (canis microti ceti pinnipedialis neotomae) conserved hypothetical protein

Comment
A N-term extension of 70aa Other strains: Brucella microti (strain CCM 4915); Brucella suis (bv. 3 str. 686; bv. 4 str. 40; ATCC 23445 / NCTC 10510); Brucella canis (ATCC 23365 / NCTC 10854); Brucella ceti (B1/94; Cudo); Brucella pinnipedialis (M292/94/1; NCTC 12890 / BCCN 94-73 / B2/94); Brucella neotomae 5K33; Brucella sp. F5/99


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Brucella suis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Brucellaceae: N E > Brucella: N E > Brucella suis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: brusu-BRA0989
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MAVLAAAALMISAGLSLAEEQPVVAVKAQNRAANAIAASMKEDKSAPKLG
EGMTMREKKKMDTDVTPEQNFSRSKQFIYRFYKPENASNELIVLLHGSGG
NETSLVPLATKIWPRATLLGIRGRVMQDGDTRWYRRITPVKFDQKDVKLE
ANAFVTFLTRLADNKDLDLAHATFVGYSNGANLLAATMLLHPDLVKRAVL
MRSMPVLDDAPVANLGKARVLTIAGEHDKLYSPYAPALSAILRASGARVD
ARTIDADHMLGEKDIATIRQWVDSLGPDGGPTVSMKAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAVLAAAALMISAGLSLAEEQPVVAVKAQNRAANAIAASMKEDKSAPKLG
EGMTMREKKKMDTDVTPEQNFSRSKQFIYRFYKPENASNELIVLLHGSGG
NETSLVPLATKIWPRATLLGIRGRVMQDGDTRWYRRITPVKFDQKDVKLE
ANAFVTFLTRLADNKDLDLAHATFVGYSNGANLLAATMLLHPDLVKRAVL
MRSMPVLDDAPVANLGKARVLTIAGEHDKLYSPYAPALSAILRASGARVD
ARTIDADHMLGEKDIATIRQWVDSLGPDGGPTVSMKAR


Reference
    Title: The Brucella suis genome reveals fundamental similarities between animal and plant pathogens and symbionts
    Paulsen IT, Seshadri R, Nelson KE, Eisen JA, Heidelberg JF, Read TD, Dodson RJ, Umayam L, Brinkac LM and Fraser CM <21 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:13148, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer