Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: emeni-q5av79

Emericella nidulans (Aspergillus nidulans) siderophore-degrading esterase AnEstA

Comment
Other strains: Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)


Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Emericella nidulans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus nidulans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6GUO: Emericella nidulans (Aspergillus nidulans) siderophore-degrading esterase AnEstA
No kinetic





No Substrate
No inhibitor
3 Genbank : AACD01000132, XM_675978, BN001304
1 UniProt : Q5AV79
1 Structure : 6GUO
2 UniProt : Q5AV79, A0A1U8QH39
2 Interpro : Q5AV79, A0A1U8QH39
2 Prodom : Q5AV79, A0A1U8QH39
2 Pfam : Q5AV79, A0A1U8QH39
2 PIRSF : Q5AV79, A0A1U8QH39
2 SUPERFAM : Q5AV79, A0A1U8QH39
Sequence
Graphical view for this peptide sequence: emeni-q5av79
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MTHWAFSPIQPGAARNMAAWQIAGKKDGPYQIDVSWPLTWSESGDASGKS
ANAVYLVDGNALFLTATETLRRRESHRPSETGTVVIAIGYPITDSVFSPR
RSYDLTPPCDHYIPPEGPDGSPKPEAHGGADEFLTFIAEIVRPFVELKVF
PRVSFGRTALFGHSYGGLFALHALFTKPSSFDVYLAASPSIWWNNRSILT
EARRFISGAALFSSAHPVLRLSFGSREQYPVRQRVESDEMFKRRQRAAEQ
RRMNDNCEELYSELLASGRLCKLEVKEYLDEDHGSVIGPALSGGIMFLSN
LSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTHWAFSPIQPGAARNMAAWQIAGKKDGPYQIDVSWPLTWSESGDASGKS
ANAVYLVDGNALFLTATETLRRRESHRPSETGTVVIAIGYPITDSVFSPR
RSYDLTPPCDHYIPPEGPDGSPKPEAHGGADEFLTFIAEIVRPFVELKVF
PRVSFGRTALFGHSYGGLFALHALFTKPSSFDVYLAASPSIWWNNRSILT
EARRFISGAALFSSAHPVLRLSFGSREQYPVRQRVESDEMFKRRQRAAEQ
RRMNDNCEELYSELLASGRLCKLEVKEYLDEDHGSVIGPALSGGIMFLSN
LSA


References
    Title: Iron Scavenging in Aspergillus Species: Structural and Biochemical Insights into Fungal Siderophore Esterases
    Ecker F, Haas H, Groll M, Huber EM
    Ref: Angew Chem Int Ed Engl, 57:14624, 2018 : PubMed

            

    Title: The 2008 update of the Aspergillus nidulans genome annotation: a community effort
    Wortman JR, Gilsenan JM, Joardar V, Deegan J, Clutterbuck J, Andersen MR, Archer D, Bencina M, Braus G and Turner G <76 more author(s)>
    Ref: Fungal Genet Biol, 46 Suppl 1:S2, 2009 : PubMed

            

    Title: Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae
    Galagan JE, Calvo SE, Cuomo C, Ma LJ, Wortman JR, Batzoglou S, Lee SI, Basturkmen M, Spevak CC and Birren BW <40 more author(s)>
    Ref: Nature, 438:1105, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer