Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: emeni-q5azp1

Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRR 194 / M139) (Aspergillus nidulans) Siderophore biosynthesis lipase/esterase, putative (AFU_orthologue; AFUA_3G03390)

Relationship
Family|Duf_1749
Block| X
Position in NCBI Life Tree|Aspergillus nidulans FGSC A4
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus nidulans: N E > Aspergillus nidulans FGSC A4: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AACD01000107, BN001301
1 UniProt : Q5AZP1
1 UniProt : Q5AZP1
1 Interpro : Q5AZP1
1 Pfam : Q5AZP1
1 PIRSF : Q5AZP1
1 SUPERFAM : Q5AZP1
Sequence
Graphical view for this peptide sequence: emeni-q5azp1
Colored MSA for Duf_1749 (raw)
MYSKFWPAGGLPGILHHFTETLVTFEFTTSATPKPHSLLFVGGLGDGLAT
TSYMADLAKALHSTDWSLFTLNLTSSYSAWGLGHLDRDTDEIAQCLNYIR
DYKSGKFASTNNSGFKGHSNSKVVLMGHSTGSQCVIHYLSKPNPHTSTKA
FDSDLQHILRTRLDGAIMQAPVSDREAIQYVLSTGWMGRTSSQVTAIYKE
LEKLAQDEVARNPDPQFDALLPLHMTGVIGYPGNVPLSARRFLSLVSPGT
PNGSPGEDDLFSSDLSDESLKKTFGMIRERGLLASKLMVLISGADQAMPG
WIDKEALLRRWRGFIDGERKDGEEEIWHEDSGLIPGASHALSNDDQAEPR
RNLVERVMRYLKGGWRLEAYRLRN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYSKFWPAGGLPGILHHFTETLVTFEFTTSATPKPHSLLFVGGLGDGLAT
TSYMADLAKALHSTDWSLFTLNLTSSYSAWGLGHLDRDTDEIAQCLNYIR
DYKSGKFASTNNSGFKGHSNSKVVLMGHSTGSQCVIHYLSKPNPHTSTKA
FDSDLQHILRTRLDGAIMQAPVSDREAIQYVLSTGWMGRTSSQVTAIYKE
LEKLAQDEVARNPDPQFDALLPLHMTGVIGYPGNVPLSARRFLSLVSPGT
PNGSPGEDDLFSSDLSDESLKKTFGMIRERGLLASKLMVLISGADQAMPG
WIDKEALLRRWRGFIDGERKDGEEEIWHEDSGLIPGASHALSNDDQAEPR
RNLVERVMRYLKGGWRLEAYRLRN


References
    Title: The 2008 update of the Aspergillus nidulans genome annotation: a community effort
    Wortman JR, Gilsenan JM, Joardar V, Deegan J, Clutterbuck J, Andersen MR, Archer D, Bencina M, Braus G and Turner G <76 more author(s)>
    Ref: Fungal Genet Biol, 46 Suppl 1:S2, 2009 : PubMed

            

    Title: Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae
    Galagan JE, Calvo SE, Cuomo C, Ma LJ, Wortman JR, Batzoglou S, Lee SI, Basturkmen M, Spevak CC and Birren BW <40 more author(s)>
    Ref: Nature, 438:1105, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer