Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gosra-a0a0d2twz7

Gossypium raimondii (New World cotton); Gossypium hirsutum (Upland cotton) (Gossypium mexicanum). Uncharacterized protein

Comment
Other strains: Gossypium raimondii (New World cotton); Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)


Relationship
Family|UCP031088
Block| X
Position in NCBI Life Tree|Gossypium raimondii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Malvales: N E > Malvaceae: N E > Malvoideae: N E > Gossypium: N E > Gossypium raimondii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: gosra-a0a0d2twz7
Colored MSA for UCP031088 (raw)
MTTLQFHSQSRFESDIRFASSTSCSFRPRRNFTLPRRFRPRPPSLHSHSS
TSLRPLPRAFSNDPAVTEKPSICTADELHYVPLPNSDWRLALWRYHPPPQ
APPRNHPLLLLSGLGTNAIGYDLSPESSFARYMSGQGFDTWILEFRGAGL
SVQASNLKELKQSADAVSEQIEAIAKSVANEVSPQKQPTGVSGYLSDSEF
YFLREDSIGIGTAWDEAKLVAELTEIFMRLSERLSGFLSESQSRLISTKL
LDQISKLLEDSQLSERFEEVRIKLANILEKQQNSVIASQIRDLSQRLVNI
IEGGQRSVSPQFIDIQERLSSTIEDFQKQLDLIVKYDWDFDHYLEEDVPA
AMEYIRAQTKPKDGKLLAIGHSMGGILLYAMLSRCGSEGREPRLKAVVTM
ASALDYRCSKPLKVLLPLADPAQALNVPAVPFGTLLAAAYPLASRPPYVL
GWLNDLISAEDMMHPELLEKLVLNNFCTIPTKLIMQLTSAFGDKGLCNRS
GKLSYRDHLNKSNVPVLAIAGDQDLICPPEAVGETAKLFPENLVTYKLFG
EPHGPHYAHYDLVGGRLAMEQVYPCIVQFLSQYDLTSLQKLL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTLQFHSQSRFESDIRFASSTSCSFRPRRNFTLPRRFRPRPPSLHSHSS
TSLRPLPRAFSNDPAVTEKPSICTADELHYVPLPNSDWRLALWRYHPPPQ
APPRNHPLLLLSGLGTNAIGYDLSPESSFARYMSGQGFDTWILEFRGAGL
SVQASNLKELKQSADAVSEQIEAIAKSVANEVSPQKQPTGVSGYLSDSEF
YFLREDSIGIGTAWDEAKLVAELTEIFMRLSERLSGFLSESQSRLISTKL
LDQISKLLEDSQLSERFEEVRIKLANILEKQQNSVIASQIRDLSQRLVNI
IEGGQRSVSPQFIDIQERLSSTIEDFQKQLDLIVKYDWDFDHYLEEDVPA
AMEYIRAQTKPKDGKLLAIGHSMGGILLYAMLSRCGSEGREPRLKAVVTM
ASALDYRCSKPLKVLLPLADPAQALNVPAVPFGTLLAAAYPLASRPPYVL
GWLNDLISAEDMMHPELLEKLVLNNFCTIPTKLIMQLTSAFGDKGLCNRS
GKLSYRDHLNKSNVPVLAIAGDQDLICPPEAVGETAKLFPENLVTYKLFG
EPHGPHYAHYDLVGGRLAMEQVYPCIVQFLSQYDLTSLQKLL


References
    Title: Genome sequence of cultivated Upland cotton (Gossypium hirsutum TM-1) provides insights into genome evolution
    Li F, Fan G, Lu C, Xiao G, Zou C, Kohel RJ, Ma Z, Shang H, Ma X and Yu S <30 more author(s)>
    Ref: Nat Biotechnol, 33:524, 2015 : PubMed

            

    Title: Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres
    Paterson AH, Wendel JF, Gundlach H, Guo H, Jenkins J, Jin D, Llewellyn D, Showmaker KC, Shu S and Schmutz J <64 more author(s)>
    Ref: Nature, 492:423, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer