Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-BPHL

Homo sapiens (Human) biphenyl hydrolase-like DJ40E16.6.3, breast epithelial mucin-associated antigen AG BPHL (mcnaa), Valacyclovir hydrolase VACVase

Comment
Valacyclovir hydrolase, biphenyl hydrolase-like, breast epithelial mucin-associated antigen AG BPHL (mcnaa) VACVase. Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol. It hydrolyzes the prodrugs of a broad range of antiviral and anticancer nucleoside analogues such as zidovudine, floxuridine, and gemcitabine OTTHUMG00000014140


Relationship
Family|Valacyclovir-hydrolase
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
4 structures (e.g. : 2OCG, 2OCI, 2OCK... more)
No kinetic





2 substrates: Valacyclovir, Valgancyclovir
1 inhbitor:
Tyrosinamide
>3 Genbank links 5 more: NM_004332, AL031963, X81372
3 UniProt : Q86WA6, Q49AI2, B4DML3
1 Ncbi-nid : 4757861
1 Ncbi-pid : 4757862
>3 Structure links 1 more: 2OCG, 2OCI, 2OCK
3 UniProt : Q86WA6, Q49AI2, B4DML3
3 Interpro : Q86WA6, Q49AI2, B4DML3
3 Pfam : Q86WA6, Q49AI2, B4DML3
3 PIRSF : Q86WA6, Q49AI2, B4DML3
3 SUPERFAM : Q86WA6, Q49AI2, B4DML3
1 EntrezGene : 670
1 SNP : 670
1 HUGO HGNC : 1094
1 OMIM : 603156
1 Ensembl : ENSG00000137274
Sequence
Graphical view for this peptide sequence: human-BPHL
Colored MSA for Valacyclovir-hydrolase (raw)
MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQ
LHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYG
HSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAA
KYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYD
YFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRF
HADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQ
LHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYG
HSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAA
KYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYD
YFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRF
HADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ


References
7 more
    Title: Human valacyclovir hydrolase/biphenyl hydrolase-like protein is a highly efficient homocysteine thiolactonase
    Marsillach J, Suzuki SM, Richter RJ, McDonald MG, Rademacher PM, Maccoss MJ, Hsieh EJ, Rettie AE, Furlong CE
    Ref: PLoS ONE, 9:e110054, 2014 : PubMed

            

    Title: The DNA sequence and analysis of human chromosome 6
    Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE and Beck S <161 more author(s)>
    Ref: Nature, 425:805, 2003 : PubMed

            

    Title: Cloning and expression analysis of a novel human serine hydrolase with sequence similarity to prokaryotic enzymes involved in the degradation of aromatic compounds
    Puente XS, Lopez-Otin C
    Ref: Journal of Biological Chemistry, 270:12926, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer