Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-DPP10

Homo sapiens (Human) DPP-10 Dipeptidyl peptidase IV-related protein-3 KIAA1492 protein (fragment)

Comment
has no active serine No dpp activity Peptidase S9 DPP_IV


Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
1 structure:
4WJL: Structure of human dipeptidyl peptidase 10 (DPPY): a modulator of neuronal Kv4 channels.
No kinetic





No Substrate
No inhibitor
>3 Genbank links 8 more: AB040925, AY172661, BC030832
>3 UniProt links 2 more: Q8N608, Q0GLB9, Q0GLB7
1 Structure : 4WJL
>3 UniProt links 2 more: Q8N608, Q0GLB9, Q0GLB7
>3 Interpro links 2 more: Q8N608, Q0GLB9, Q0GLB7
>3 Prodom links 2 more: Q8N608, Q0GLB9, Q0GLB7
>3 Pfam links 2 more: Q8N608, Q0GLB9, Q0GLB7
>3 PIRSF links 2 more: Q8N608, Q0GLB9, Q0GLB7
>3 SUPERFAM links 2 more: Q8N608, Q0GLB9, Q0GLB7
1 EntrezGene : 57628
1 SNP : 57628
1 UniGene : 580539
1 HUGO HGNC : 20823
1 OMIM : 608209
1 Ensembl : ENSG00000175497
Sequence
Graphical view for this peptide sequence: human-DPP10
Colored MSA for DPP4N_Peptidase_S9 (raw)
ARWINDTDVVYKSENGHVIKLNIETNATTLLLENTTFVTFKASRHSVSPD
LKYVLLAYDVKQIFHYSYTASYVIYNIHTREVWELNPPEVEDSVLQYAAW
GVQGQQLIYIFENNIYYQPDIKSSSLRLTSSGKEEIIFNGIADWLYEEEL
LHSHIAHWWSPDGERLAFLMINDSLVPTMVIPRFTGALYPKGKQYPYPKA
GQVNPTIKLYVVNLYGPTHTLELMPPDSFKSREYYITMVKWVSNTKTVVR
WLNRPQNISILTVCETTTGACSKKYEMTSDTWLSQQNEEPVFSRDGSKFF
MTVPVKQGGRGEFHHIAMFLIQSKSEQITVRHLTSGNWEVIKILAYDETT
QKIYFLSTESSPRGRQLYSASTEGLLNRQCISCNFMKEQCTYFDASFSPM
NQHFLLFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKKIGKPEI
KILHIDDYELPLQLSLPKDFMDRNQYALLLIMDEEPGGQLVTDKFHIDWD
SVLIDMDNVIVARFDGRGSGFQGLKILQEIHRRLGSVEVKDQITAVKFLL
KLPYIDSKRLSIFGKGYGGYIASMILKSDEKLFKCGSVVAPITDLKLYAS
AFSERYLGMPSKEESTYQAASVLHNVHGLKEENILIIHGTADTKVHFQHS
AELIKHLIKAGVNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEI
SVLPQEPEEDE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ARWINDTDVVYKSENGHVIKLNIETNATTLLLENTTFVTFKASRHSVSPD
LKYVLLAYDVKQIFHYSYTASYVIYNIHTREVWELNPPEVEDSVLQYAAW
GVQGQQLIYIFENNIYYQPDIKSSSLRLTSSGKEEIIFNGIADWLYEEEL
LHSHIAHWWSPDGERLAFLMINDSLVPTMVIPRFTGALYPKGKQYPYPKA
GQVNPTIKLYVVNLYGPTHTLELMPPDSFKSREYYITMVKWVSNTKTVVR
WLNRPQNISILTVCETTTGACSKKYEMTSDTWLSQQNEEPVFSRDGSKFF
MTVPVKQGGRGEFHHIAMFLIQSKSEQITVRHLTSGNWEVIKILAYDETT
QKIYFLSTESSPRGRQLYSASTEGLLNRQCISCNFMKEQCTYFDASFSPM
NQHFLLFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKKIGKPEI
KILHIDDYELPLQLSLPKDFMDRNQYALLLIMDEEPGGQLVTDKFHIDWD
SVLIDMDNVIVARFDGRGSGFQGLKILQEIHRRLGSVEVKDQITAVKFLL
KLPYIDSKRLSIFGKGYGGYIASMILKSDEKLFKCGSVVAPITDLKLYAS
AFSERYLGMPSKEESTYQAASVLHNVHGLKEENILIIHGTADTKVHFQHS
AELIKHLIKAGVNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEI
SVLPQEPEEDE


References
10 more
    Title: DPP10 is a new regulator of Nav1.5 channels in human heart
    Belau F, Metzner K, Christ T, Ravens U, Schaefer M, Kunzel S, Li W, Wettwer E, Dobrev D and Kammerer S <1 more author(s)>
    Ref: Int J Cardiol, 284:68, 2019 : PubMed

            

    Title: Cloning and characterization of dipeptidyl peptidase 10, a new member of an emerging subgroup of serine proteases
    Qi SY, Riviere PJ, Trojnar J, Junien JL, Akinsanya KO
    Ref: Biochemical Journal, 373:179, 2003 : PubMed

            

    Title: Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro
    Nagase T, Kikuno R, Ishikawa K, Hirosawa M, Ohara O
    Ref: DNA Research, 7:143, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer