Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lactc-c5dez1

Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans) KLTH0D10912p

Relationship
Family|Duf_1749
Block| X
Position in NCBI Life Tree|Lachancea thermotolerans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Lachancea: N E > Lachancea thermotolerans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CU928168
1 UniProt : C5DEZ1
1 UniProt : C5DEZ1
1 Interpro : C5DEZ1
1 Pfam : C5DEZ1
1 PIRSF : C5DEZ1
1 SUPERFAM : C5DEZ1
Sequence
Graphical view for this peptide sequence: lactc-c5dez1
Colored MSA for Duf_1749 (raw)
MSFSGVLHKYASRRVAFEFNSTPSKKVVVFIGGLGDGLLTVPYVPKLAQE
LGSLGWSVIQIQFTSSFKGWGLTSLDQDVSEIKELVDYLKSTEGGSRERI
VLFGHSTGSQDTMHYLLKFGDTIDAGVLQASVSDREFFGQAVDKETWNRL
NSKAKELVDKGQKDEILPLEYAKVMSETPVTAYRWCSLALPGGDDDYFSS
DIPDETLKTTFGRVKKPFLVAYSEQDQIVPAYVDKKKLLDRWQACSNTDF
WSKNSGLVNGANHQIEQVQSQDQLLSMVREFLTEFQL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSFSGVLHKYASRRVAFEFNSTPSKKVVVFIGGLGDGLLTVPYVPKLAQE
LGSLGWSVIQIQFTSSFKGWGLTSLDQDVSEIKELVDYLKSTEGGSRERI
VLFGHSTGSQDTMHYLLKFGDTIDAGVLQASVSDREFFGQAVDKETWNRL
NSKAKELVDKGQKDEILPLEYAKVMSETPVTAYRWCSLALPGGDDDYFSS
DIPDETLKTTFGRVKKPFLVAYSEQDQIVPAYVDKKKLLDRWQACSNTDF
WSKNSGLVNGANHQIEQVQSQDQLLSMVREFLTEFQL


Reference
    Title: Comparative genomics of protoploid Saccharomycetaceae
    Souciet JL, Dujon B, Gaillardin C, Johnston M, Baret PV, Cliften P, Sherman DJ, Weissenbach J, Westhof E and Talla E <44 more author(s)>
    Ref: Genome Res, 19:1696, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer