Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: leima-q4qec8

Leishmania major Putative uncharacterized protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Leishmania major
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Euglenozoa: N E > Kinetoplastida: N E > Trypanosomatidae: N E > Leishmaniinae: N E > Leishmania [genus]: N E > Leishmania [subgenus]: N E > Leishmania major species complex: N E > Leishmania major: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FR796413
1 UniProt : Q4QEC8
1 UniProt : Q4QEC8
1 Interpro : Q4QEC8
1 Prodom : Q4QEC8
1 Pfam : Q4QEC8
1 PIRSF : Q4QEC8
1 SUPERFAM : Q4QEC8
Sequence
Graphical view for this peptide sequence: leima-q4qec8
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MPTTVLYHGDQLGPRPLVILDHSVARLEQSATAVLDACQEAAKRYEAMLS
SLAWDHGAVFVPLQVSIGEINVMEQSCRHVCAVLDAMDVQWSHVLAHSYG
ALVAARMAASTAYPHRIGSLLLLDTPLVTEQLVRNTKQREEIAKAKKDVN
VPPAELSFAIESLRSALETTLPYPAAVDKSLYEDHLFSSASVFREKGLVR
DEHRYVPVRHLAQVHHPLQLLVPVKQPITDVAIHREFFGLRRPAVIKTAD
NHEDLFSAKCADEVADVVRAWMQRFEPDVVMKRRFEKAAKEMVQLMGSSA
SFGEKGGGNIEKSEKKEKRKGRQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPTTVLYHGDQLGPRPLVILDHSVARLEQSATAVLDACQEAAKRYEAMLS
SLAWDHGAVFVPLQVSIGEINVMEQSCRHVCAVLDAMDVQWSHVLAHSYG
ALVAARMAASTAYPHRIGSLLLLDTPLVTEQLVRNTKQREEIAKAKKDVN
VPPAELSFAIESLRSALETTLPYPAAVDKSLYEDHLFSSASVFREKGLVR
DEHRYVPVRHLAQVHHPLQLLVPVKQPITDVAIHREFFGLRRPAVIKTAD
NHEDLFSAKCADEVADVVRAWMQRFEPDVVMKRRFEKAAKEMVQLMGSSA
SFGEKGGGNIEKSEKKEKRKGRQ


Reference
    Title: The genome of the kinetoplastid parasite, Leishmania major
    Ivens AC, Peacock CS, Worthey EA, Murphy L, Aggarwal G, Berriman M, Sisk E, Rajandream MA, Adlem E and Myler PJ <91 more author(s)>
    Ref: Science, 309:436, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer