Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lisin-LIN0589

Listeria innocua hypothetical protein lin0589

Comment
Other strains: Listeria innocua (strains: serovar 6a (strain CLIP 11262); FSL J1-023; FSL S4-378)


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Listeria innocua
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria innocua: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AL596165
1 UniProt : Q92E71
1 UniProt : Q92E71
1 Interpro : Q92E71
1 Prodom : Q92E71
1 Pfam : Q92E71
1 PIRSF : Q92E71
1 SUPERFAM : Q92E71
Sequence
Graphical view for this peptide sequence: lisin-LIN0589
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MYAYDIYEPIGRKDGEIFPVIFALHGFGGDELDMAGRLELLMDRFVVVSM
RGDVEYGPTYGFYHMVTEGDPNAREVDYTSLRVAEFIDEVCNDYVSIDKN
QIFLVGFDQGAVLTISIMQSYGGQYKAAALLSGRLPHYLEERPANLMLKD
KRIFIGHGIEDAVIQIAEAEEIAQFFQKMGCNVEKHSYFVGHNVNEAEED
DLYSWFESFLPNQNQPVKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYAYDIYEPIGRKDGEIFPVIFALHGFGGDELDMAGRLELLMDRFVVVSM
RGDVEYGPTYGFYHMVTEGDPNAREVDYTSLRVAEFIDEVCNDYVSIDKN
QIFLVGFDQGAVLTISIMQSYGGQYKAAALLSGRLPHYLEERPANLMLKD
KRIFIGHGIEDAVIQIAEAEEIAQFFQKMGCNVEKHSYFVGHNVNEAEED
DLYSWFESFLPNQNQPVKK


References
    Title: Comparative genomics of the bacterial genus Listeria: Genome evolution is characterized by limited gene acquisition and limited gene loss
    den Bakker HC, Cummings CA, Ferreira V, Vatta P, Orsi RH, Degoricija L, Barker M, Petrauskene O, Furtado MR, Wiedmann M
    Ref: BMC Genomics, 11:688, 2010 : PubMed

            

    Title: Comparative genomics of Listeria species
    Glaser P, Frangeul L, Buchrieser C, Rusniok C, Amend A, Baquero F, Berche P, Bloecker H, Brandt P and Cossart P <45 more author(s)>
    Ref: Science, 294:849, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer