Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-1neur

Mus musculus (Mouse) neuroligin 1, KIAA1070 clone MGC:7622 complete cds

Comment
NGLN1_MOUSE associated with primary accession number: Q99K10 was renamed to NLGN1_MOUSE


Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3B3Q: Crystal structure of a synaptic adhesion complex: neuroligin-neurexin
No kinetic





No Substrate
No inhibitor
>3 Genbank links 9 more: BC098461, BC005523, AK122433
>3 UniProt links 1 more: Q99K10, Q4KMN5, Q3UUP2
1 Ncbi-nid : 13529631
1 Ncbi-pid : 13529632
1 Structure : 3B3Q
>3 UniProt links 1 more: Q4KMN5, Q3UUP2, Q99K10
>3 Interpro links 1 more: Q4KMN5, Q3UUP2, Q99K10
>3 Prodom links 1 more: Q4KMN5, Q3UUP2, Q99K10
>3 Pfam links 1 more: Q4KMN5, Q3UUP2, Q99K10
>3 PIRSF links 1 more: Q4KMN5, Q3UUP2, Q99K10
>3 SUPERFAM links 1 more: Q4KMN5, Q3UUP2, Q99K10
1 MGD : 2179435
2 ENSEMBL : Q99K10, ENSMUSG00000063887
Sequence
Graphical view for this peptide sequence: mouse-1neur
Colored MSA for Neuroligin (raw)
MALPRCMWPNYVWRAMMACVVHRGSGAPLTLCLLGCLLQTFHVLSQKLDD
VDPLVTTNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGEHRFQPPEP
PSPWSDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQS
EDCLYLNIYVPTEDGPLTKKHTDDLGDNDGAEDEDIRDSGGPKPVMVYIH
GGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLSTGDQAAKGNYG
LLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNR
WSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARILATKVGCNVSDTVEL
VECLQKKPYKELVDQDVQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLN
YDIMLGVNQGEGLKFVENIVDSDDGVSASDFDFAVSNFVDNLYGYPEGKD
VLRETIKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFG
SPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSK
NDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQ
KDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVP
STDITLRPTRKNSTPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTI
AVGASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAPEEEI
MSLQMKHTDLDHECESIHPHEVVLRTACPPDYTLAMRRSPDDIPLMTPNT
ITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MALPRCMWPNYVWRAMMACVVHRGSGAPLTLCLLGCLLQTFHVLSQKLDD
VDPLVTTNFGKIRGIKKELNNEILGPVIQFLGVPYAAPPTGEHRFQPPEP
PSPWSDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQS
EDCLYLNIYVPTEDGPLTKKHTDDLGDNDGAEDEDIRDSGGPKPVMVYIH
GGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLSTGDQAAKGNYG
LLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGSCVNLLTLSHYSEGNR
WSNSTKGLFQRAIAQSGTALSSWAVSFQPAKYARILATKVGCNVSDTVEL
VECLQKKPYKELVDQDVQPARYHIAFGPVIDGDVIPDDPQILMEQGEFLN
YDIMLGVNQGEGLKFVENIVDSDDGVSASDFDFAVSNFVDNLYGYPEGKD
VLRETIKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFG
SPTYFYAFYHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSK
NDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQ
KDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVP
STDITLRPTRKNSTPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTI
AVGASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAPEEEI
MSLQMKHTDLDHECESIHPHEVVLRTACPPDYTLAMRRSPDDIPLMTPNT
ITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV


References
    Title: Lineage-specific biology revealed by a finished genome assembly of the mouse
    Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL and Ponting CP <21 more author(s)>
    Ref: PLoS Biol, 7:e1000112, 2009 : PubMed

            

    Title: Structural basis for synaptic adhesion mediated by neuroligin-neurexin interactions
    Chen X, Liu H, Shim AH, Focia PJ, He X
    Ref: Nat Struct Mol Biol, 15:50, 2008 : PubMed

            

    Title: Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries
    Okazaki N, Kikuno R, Ohara R, Inamoto S, Aizawa H, Yuasa S, Nakajima D, Nagase T, Ohara O, Koga H
    Ref: DNA Research, 10:35, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer