Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neucr-q7sdx9

Neurospora crassa bud emergence 46 (BEM46) protein

Comment
bud emergence 46 (BEM46) protein from Neurospora crassa is required for cell type-specific polarity formation. Other strains: (ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Neurospora crassa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Sordariales: N E > Sordariaceae: N E > Neurospora: N E > Neurospora crassa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : XP_964202, XP_011393132
3 UniProt : V5IRL5, A0A0B0DKY0, V5IQR2
3 Interpro : V5IRL5, A0A0B0DKY0, V5IQR2
3 Prodom : V5IRL5, A0A0B0DKY0, V5IQR2
3 Pfam : V5IRL5, A0A0B0DKY0, V5IQR2
3 PIRSF : V5IRL5, A0A0B0DKY0, V5IQR2
3 SUPERFAM : V5IRL5, A0A0B0DKY0, V5IQR2
Sequence
Graphical view for this peptide sequence: neucr-q7sdx9
Colored MSA for ABHD13-BEM46 (raw)
MSSPSVTPPAPDGNSFLVQIVSLLSSAASHLRLPVIASTGVAAILTGLLY
FKQKALIYPSHMPPGSRTDIPRPSFYRIKDYEELIIPTKDGEKLSAFYIR
GPKGGSNSKVTVIMFHGNAGNIGHRLPIARMLLQAAGCNIFMLEYRGYGI
STGHPDESGLNIDAQTALDYLRDRAETRDHKYIVYGQSLGGAVSVKLVSK
NQGRGDIAGLILENTFLSMRKLIPSIIPPARYLASLCHQVWATDTLIGNV
KVPTLFLSGLQDEIVPPTHMKQLYHLSNAPIKIWKPLPNGDHNSSVLEEG
YFEAIAEFIQRVSSGDPEKKKIIDV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSSPSVTPPAPDGNSFLVQIVSLLSSAASHLRLPVIASTGVAAILTGLLY
FKQKALIYPSHMPPGSRTDIPRPSFYRIKDYEELIIPTKDGEKLSAFYIR
GPKGGSNSKVTVIMFHGNAGNIGHRLPIARMLLQAAGCNIFMLEYRGYGI
STGHPDESGLNIDAQTALDYLRDRAETRDHKYIVYGQSLGGAVSVKLVSK
NQGRGDIAGLILENTFLSMRKLIPSIIPPARYLASLCHQVWATDTLIGNV
KVPTLFLSGLQDEIVPPTHMKQLYHLSNAPIKIWKPLPNGDHNSSVLEEG
YFEAIAEFIQRVSSGDPEKKKIIDV


References
1 more
    Title: BEM46 shows eisosomal localization and association with tryptophan-derived auxin pathway in Neurospora crassa
    Kollath-Leiss K, Bonniger C, Sardar P, Kempken F
    Ref: Eukaryot Cell, 13:1051, 2014 : PubMed

            

    Title: Characterization of bud emergence 46 (BEM46) protein: Sequence, structural, phylogenetic and subcellular localization analyses
    Kumar A, Kollath-Leiss K, Kempken F
    Ref: Biochemical & Biophysical Research Communications, 438:526, 2013 : PubMed

            

    Title: The genome sequence of the filamentous fungus Neurospora crassa
    Galagan JE, Calvo SE, Borkovich KA, Selker EU, Read ND, Jaffe D, FitzHugh W, Ma LJ, Smirnov S and Birren B <67 more author(s)>
    Ref: Nature, 422:859, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer