Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: phypa-a9sg07

Physcomitrella patens subsp. patens (Moss) PpKAI2-like H Predicted protein

Comment
PpKAI2L-H cleaves both (-)-GR24 and (+)-GR24. PpKAI2L-H on (+/-)-GC242 is explained by the presence of a specific leucine residue Leu28 instead of the phenylalanine found in AtD14 (Phe26)


Relationship
Family|RsbQ-like
Block| X
Position in NCBI Life Tree|Physcomitrella patens subsp. patens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Bryophyta: N E > Bryophytina: N E > Bryopsida: N E > Funariidae: N E > Funariales: N E > Funariaceae: N E > Physcomitrella: N E > Physcomitrella patens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6AZD: Physcomitrella patens (Moss) a9sg07 PpKAI2-like H
No kinetic





1 substrate:
GC242
No inhibitor
1 Genbank : DS544963
1 UniProt : A9SG07
1 Structure : 6AZD
1 UniProt : A9SG07
1 Interpro : A9SG07
1 Pfam : A9SG07
1 PIRSF : A9SG07
1 SUPERFAM : A9SG07
Sequence
Graphical view for this peptide sequence: phypa-a9sg07
Colored MSA for RsbQ-like (raw)
MPSPLLSTHNVTVLGNRSDPVVVLGHGLGTDQSVWKYTVPSLVNQNFQVV
LYDTMGAGSTETSDFNFKRYSSLQGHVDDLLAILDELEIENCVYVGHSMS
GMIGVLASLERPDLFRKLILLSASPRYLNDSSYYGGFEQEDLDQLFSSMR
SNFSAWVSGFATAAVGTDIHDEAVQEFSSTFISMRPDVALRTSQFVFQSD
FRSILSEVTVPCHIVQSRKDIAVPIEVAEYLRCNLGGWTSVDILQTDGHL
PQLSCPELVVPVLLHCIDS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPSPLLSTHNVTVLGNRSDPVVVLGHGLGTDQSVWKYTVPSLVNQNFQVV
LYDTMGAGSTETSDFNFKRYSSLQGHVDDLLAILDELEIENCVYVGHSMS
GMIGVLASLERPDLFRKLILLSASPRYLNDSSYYGGFEQEDLDQLFSSMR
SNFSAWVSGFATAAVGTDIHDEAVQEFSSTFISMRPDVALRTSQFVFQSD
FRSILSEVTVPCHIVQSRKDIAVPIEVAEYLRCNLGGWTSVDILQTDGHL
PQLSCPELVVPVLLHCIDS


References
    Title: The Physcomitrium (Physcomitrella) patens PpKAI2L receptors for strigolactones and related compounds function via MAX2-dependent and independent pathways
    Lopez-Obando M, Guillory A, Boyer FD, Cornu D, Hoffmann B, Le Bris P, Pouvreau JB, Delavault P, Rameau C and Bonhomme S <1 more author(s)>
    Ref: Plant Cell, :, 2021 : PubMed

            

    Title: Structural Basis of Karrikin and Non-natural Strigolactone Perception in Physcomitrella patens
    Burger M, Mashiguchi K, Lee HJ, Nakano M, Takemoto K, Seto Y, Yamaguchi S, Chory J
    Ref: Cell Rep, 26:855, 2019 : PubMed

            

    Title: The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants
    Rensing SA, Lang D, Zimmer AD, Terry A, Salamov A, Shapiro H, Nishiyama T, Perroud PF, Lindquist EA and Boore JL <60 more author(s)>
    Ref: Science, 319:64, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer