(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Fungi: NE > Dikarya: NE > Ascomycota: NE > saccharomyceta: NE > Saccharomycotina: NE > Saccharomycetes: NE > Saccharomycetales: NE > Saccharomycetaceae: NE > Saccharomyces: NE > Saccharomyces cerevisiae: NE
6_AlphaBeta_hydrolase : yeast-SCYNR064CSaccharomycescerevisiae SCYNR064C, yeast-ynl5Saccharomyces cerevisiae (Baker's yeast) YNL115C hypothetical 74.0 kda protein in mls1-rpc19 intergenic region, yeast-YOR084W Saccharomyces cerevisiae (Baker's yeast) Peroxisomal membrane protein LPX1 chromosome xv reading frame orf yor084w, yeast-ymc0Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). Uncharacterized protein YML020W. A85-EsteraseD-FGH : yeast-yjg8 Saccharomyces cerevisiae (Baker's yeast)(strains RM11-1a; LalvinEC1118/Prise de mousse; ATCC 204508/S288c; AWRI1631; JAY291; YJM789) Putative uncharacterized protein (EC 3.1.1.1). ABHD11-Acetyl_transferase : yeast-yg1lSaccharomyces cerevisiae (Baker's yeast) IMO32 hypothetical 38.5 kda protein in erv1-gls2 intergenic region, yeast-yg19Saccharomyces cerevisiae (Baker's yeast) EAT1 YGR015C hypothetical 37.9 kda protein in msb2-uga1 intergenic region. ABHD13-BEM46 : yeast-yn60Saccharomyces cerevisiae (Baker's yeast) hypothetical 32.3 kda protein in kre1-hxt14 intergenic region. abh_upf0017 : yeast-MCFS1Saccharomyces cerevisiae (Baker's yeast) Acyl-coenzymeA:ethanol O-acyltransferase 51.7 kda sec62-msy1 intergenic region ypl095c, yeast-MCFS2Saccharomyces cerevisiae (Baker's yeast) EHT1, MCFS2, YBR177C, YBR1239 alcohol acyl transferase (octanoyl-CoA:ethanol acyltransferase also thioesterase), yeast-ym60Saccharomyces cerevisiae (Baker's yeast) monoacylglycerol lipase YMR210W 51.4 kda protein YM8261.04 in rar1-scj1 intergenic region. Acidic_Lipase : yeast-tgl1Saccharomyces cerevisiae (Baker's yeast) triglyceride lipase-cholesterol esterase (EC 3.1.1.-) Tgl1p, yeast-YLR020CSaccharomyces cerevisiae (Baker's yeast) chromosome xii ylr020c Yeh2p. AlphaBeta_hydrolase : yeast-LDH1Saccharomyces cerevisiae (Yeast) Lipid droplet hydrolase 1 chromosome II reading frame ORF YBR204c, yeast-YDL057WSaccharomyces cerevisiae (Baker's yeast) chromosome IV reading frame orf ydl057w. Arb2_domain : yeast-hda1 Saccharomyces cerevisiae (Baker's yeast); Saccharomyces cerevisiae x Saccharomyces kudriavzevii . Histone deacetylase HDA1 (only c-term Arb2 domain). Carboxypeptidase_S10 : yeast-cbpy1 Saccharomyces cerevisiae Carboxypeptidase Y, vacuolar PRC1 gene encoding preproprotein carboxypeptidase Y (CPY), yeast-kex01 Saccharomyces cerevisiae, yeast Pheromone-processing carboxypeptidase KEX1, yeast-yby9Saccharomyces cerevisiae chromosome II reading frame ORF YBR139w. CGI-58_ABHD5_ABHD4 : yeast-cld1Saccharomyces cerevisiae (Baker's yeast) YGR110W hypothetical 52.0 kda protein in clb6-shy1 intergenic region, yeast-ECM18Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a; JAY291) hypothetical 53.2 kda extracellular matrix protein 18, yeast-ict1Saccharomyces cerevisiae (Baker's yeast) chromosome XII reading frame orf ylr099c Increased copper tolerance protein 1. Dienelactone_hydrolase : yeast-AIM2Saccharomyces cerevisiae (Baker's yeast) yae9 hypothetical 27.1 kda protein in acs1-gcv3 intergenic region, yeast-dlhhSaccharomyces cerevisiae (Baker's yeast) hydrolase) (dlh). DPP4N_Peptidase_S9 : yeast-dap1Saccharomyces cerevisiae (Baker's yeast) dipeptidyl aminopeptidase (STE13 or YCI1), yeast-dap2Saccharomyces cerevisiae (Baker's yeast) yhr028c gene for dipeptidyl aminopeptidase B (DPAP B). Duf_676 : yeast-ROG1Saccharomyces cerevisiae (Baker's yeast) Putative lipase ROG1 ygo4 78.1 kda protein in tip20-mrf1 intergenic region ygl144c, yeast-YDL109CSaccharomyces cerevisiae (Baker's yeast) chromosome IV reading frame orf ydl109c, yeast-YDR444WSaccharomyces cerevisiae (Baker's yeast) d9461.29p, yeast-yo059Saccharomyces cerevisiae (Baker's yeast) Putative lipase YOR059C LPL1 chromosome xv orf yor059c YOR29-10. Duf_726 : yeast-yfd4Saccharomyces cerevisiae (Baker's yeast) (strains YJM789; RM11-1a; AWRI1631) Uncharacterized membrane protein Mil1 YFL034W. Duf_2235 : yeasv-e7ltm5Saccharomyces cerevisiae (strain VIN 13) (Baker's yeast). YEL023C-like protein. FSH1 : yeast-FSH1 Saccharomyces cerevisiae (Baker's yeast); Saccharomyces arboricola; Saccharomyces eubayanus family of serine hydrolases 1 (EC 3.1.-.-) in aap1-smf2 intergenic region, yeast-FSH2Saccharomyces cerevisiae (Baker's yeast) hypothetical 24.5 kda protein in erg8-ubp8 intergenic region, yeast-FSH3Saccharomyces cerevisiae (Baker's yeast) hypothetical dihydrofolate reductase. Homoserine_transacetylase : yeast-met2Saccharomyces cerevisiae (Baker's yeast), Saccharomyces sp., Saccharomyces paradoxus, S. uvarum, S. bayanus, S. pastorianus, S carlsbergensis, S. bayanus x S. cerevisiae, Homoserine O-trans-acetylase. Kynurenine-formamidase : yeast-YDR428C Saccharomyces cerevisiae (Baker's yeast); Saccharomyces sp. Kynurenine formamidase KFA d9461.15p. LIDHydrolase : yeast-YPR147CSaccharomyces cerevisiae (Baker's yeast) YPR147cp lipid droplet associated enzyme triacylglycerol lipase and ester hydrolase. Lipase_3 : yeast-ATG15CDS from: Saccharomyces cerevisiae (and strain YJM789) lipase involved in lipid vesicles degradation YCR068W Cytoplasm to vacuole targeting protein 17 ATG15, yeast-yj77Saccharomyces cerevisiae chromosome X reading frame ORF YJR107w. LYsophospholipase_carboxylesterase : yeast-YLR118cSaccharomyces cerevisiae Ylr118c protein and gene in chromosome XII cosmid 9233. Monoglyceridelipase_lysophospholip : yeast-mgll Saccharomyces cerevisiae (Baker's yeast) MGLL Yju3p YKL094W YKL441 Monoglyceride lipase. PC-sterol_acyltransferase : yeast-pdatSaccharomyces cerevisiae (Baker's yeast) phospholipid:diacylglycerol acyltransferase (EC 2.3.1.158) (pdat) LRO1, yeast-yj68Saccharomyces cerevisiae (Baker's yeast) (and strain AWRI1631) hypothetical 74.1 kda protein in acr1-yuh1 intergenic region. PGAP1 : yeast-BST1Saccharomyces cerevisiae (Baker's yeast), BST1, YFL025C, GPI inositol-deacylase, yeast-tgl2Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; JAY291; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a) lipase 2 (EC 3.1.1.3) (triacylglycerol lipase). PPase_methylesterase_euk : yeast-ppme1Saccharomyces cerevisiae (Baker's yeast) protein phosphatase methylesterase 1 (EC 3.1.1.-) (pme-1) (yms2). Steryl_acetyl_hydrolase : yeast-SAY1Saccharomyces cerevisiae (Baker's yeast) hypothetical 48.5da prot YG5J chromosome VII
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Saccharomyces cerevisiae S288c: N, E.
Saccharomyces cerevisiae YJM789: N, E.
Saccharomyces cerevisiae RM11-1a: N, E.
Saccharomyces cerevisiae AWRI1631: N, E.
Saccharomyces cerevisiae JAY291: N, E.
Saccharomyces cerevisiae EC1118: N, E.
Saccharomyces cerevisiae AWRI796: N, E.
Saccharomyces cerevisiae Lalvin QA23: N, E.
Saccharomyces cerevisiae Vin13: N, E.
Saccharomyces cerevisiae FostersO: N, E.
Saccharomyces cerevisiae FostersB: N, E.
Saccharomyces cerevisiae VL3: N, E.
Saccharomyces cerevisiae Kyokai no. 7: N, E.
Saccharomyces cerevisiae P301: N, E.
Saccharomyces cerevisiae R103: N, E.
Saccharomyces cerevisiae CEN.PK113-7D: N, E.
Saccharomyces cerevisiae R008: N, E.
Saccharomyces cerevisiae P283: N, E.
Saccharomyces cerevisiae YJM993: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MGVSAVLKRARNLLATFIVCCFMAVVLVLALAHHFINEHRDTRSSSTQIE VDDESKRNVHHDHVLTRTNAYATPYLDLEHDKKNGIVYDHTRTVVRKKNH EVGSSSLHKNLFHKFLTKLIFRFIEKEKVTEGVTQGKFNNSSNEIANHEP VFEKIPVQCDNPLQNLILSEDLTLVADLNYYFNQYNIQIEEFRLETEDGF VIDLWHLIPKYRTTDSDKKKRPPILMLHGLLQSSGSFASNGRKSLAYFLY QSGYDIWLGNNRCGFRPEWNEAKVPTLASRWDWDLREMVKYDLTLLIDTV LAKTQFEKLTLISHSQGTTQGFMGLVNEDKFFPPGSGSKESFFTSKIANY IALAPAVYPGPLLNEKLFVKLMTKEIENPWFFGETSFFEIMMIVRNLCVG ESLFSFVCYTIFNYLFDWNDTLWDTALRDRHFLFSPVHVSVKLMQWWLSP DPNKVSFKFGSHKMFPDNVKWFSDASKAPNIYLFVPKQDRLVDGERLINH FVNVESNVNYKIWYIDEYAHIDVLWAHDVIERIGKPILQNLNNYYSKKPS SAFESDCSDTEVETELEMVAEKA
References
6 moreTitle: Sequence analysis of the CEN12 region of Saccharomyces cerevisiae on a 43.7 kb fragment of chromosome XII including an open reading frame homologous to the human cystic fibrosis transmembrane conductance regulator protein CFTR Miosga T, Zimmermann FK Ref: Yeast, 12:693, 1996 : PubMed
In the framework of the European Union BIOTECH project for systematically sequencing the Saccharomyces cerevisiae genome, we determined the nucleotide sequence of a 43.7 kb DNA fragment spanning the centromeric region of chromosome XII. A novel approach was the distribution of sublibraries prepared by the DNA coordinator (J. Hoheisel, Heidelberg, FRG), using a new hybridization-based DNA mapping method, in order to facilitate ordered sequencing. The sequence contains 22 open reading frames (ORFs) longer than 299 bp, including the published sequences for ATS/DPS1, SCD25, SOF1, DRS1, MMM1, DNM1 and the centromeric region CEN12. Five putative ORF products show similarity to known proteins: the leucine zipper-containing ABC transporter L1313p to the yeast Ycflp metal resistance protein, to the yeast putative ATP-dependent permease Yhd5p, to the yeast putative proteins Yk83p and Yk84p, to the human cystic fibrosis transmembrane conductance regulator protein (hCFTR) and to the human multidrug resistance-associated protein hMRP1; L1325p to the Drosophila melanogaster Pumilio protein, to the putative yeast regulatory protein Yg13p and to the yeast protein Mpt5p/Htrlp; L1329p to human lipase A and gastric lipase, to rat lingual lipase and to the putative yeast triglyceride lipase Tg11p; L1341p to the putative yeast protein Yhg4p; and the leucine zipper-containing L1361p to the two yeast proteins 00953p and Ym8156.08p and to the Arabidopsis thaliana protein HYP1. Eight ORFs show no homology to known sequences in the database, three small ORFs are internal and complementary to larger ones and L1301 is complementary overlapping the ATS/DPS1 gene. Additionally three equally spaced ARS consensus sequences were found.
        
Title: MMM1 encodes a mitochondrial outer membrane protein essential for establishing and maintaining the structure of yeast mitochondria Burgess SM, Delannoy M, Jensen RE Ref: Journal of Cell Biology, 126:1375, 1994 : PubMed
In the yeast Saccharomyces cerevisiae, mitochondria are elongated organelles which form a reticulum around the cell periphery. To determine the mechanism by which mitochondrial shape is established and maintained, we screened yeast mutants for those defective in mitochondrial morphology. One of these mutants, mmm1, is temperature-sensitive for the external shape of its mitochondria. At the restrictive temperature, elongated mitochondria appear to quickly collapse into large, spherical organelles. Upon return to the permissive temperature, wild-type mitochondrial structure is restored. The morphology of other cellular organelles is not affected in mmm1 mutants, and mmm1 does not disrupt normal actin or tubulin organization. Cells disrupted in the MMM1 gene are inviable when grown on nonfermentable carbon sources and show abnormal mitochondrial morphology at all temperatures. The lethality of mmm1 mutants appears to result from the inability to segregate the aberrant-shaped mitochondria into daughter cells. Mitochondrial structure is therefore important for normal cell function. Mmm1p is located in the mitochondrial outer membrane, with a large carboxyl-terminal domain facing the cytosol. We propose that Mmm1p maintains mitochondria in an elongated shape by attaching the mitochondrion to an external framework, such as the cytoskeleton.
        
Title: A putative ATP-dependent RNA helicase involved in Saccharomyces cerevisiae ribosome assembly Ripmaster TL, Vaughn GP, Woolford JL, Jr. Ref: Proc Natl Acad Sci U S A, 89:11131, 1992 : PubMed
We have isolated a cold-sensitive mutant of Saccharomyces cerevisiae in which there is a deficit of 60S ribosomal subunits. Cold sensitivity and the assembly defect are recessive and cosegregate, defining a single essential gene that we designated DRS1 (deficiency of ribosomal subunits). The wild-type DRS1 gene was cloned by complementation of the cold-sensitive phenotype of drs1. Sequence analysis reveals a high degree of similarity to a family of proteins that are thought to function as ATP-dependent RNA helicases. Pulse-chase analysis of ribosomal RNA synthesis and processing indicates that the drs1 mutant accumulates the 27S precursor of the mature 25S rRNA. These results suggest that, as in pre-mRNA splicing, RNA helicase activities are involved in ribosomal RNA processing.
Human intervention has subjected the yeast Saccharomyces cerevisiae to multiple rounds of independent domestication and thousands of generations of artificial selection. As a result, this species comprises a genetically diverse collection of natural isolates as well as domesticated strains that are used in specific industrial applications. However the scope of genetic diversity that was captured during the domesticated evolution of the industrial representatives of this important organism remains to be determined. To begin to address this, we have produced whole-genome assemblies of six commercial strains of S. cerevisiae (four wine and two brewing strains). These represent the first genome assemblies produced from S. cerevisiae strains in their industrially-used forms and the first high-quality assemblies for S. cerevisiae strains used in brewing. By comparing these sequences to six existing high-coverage S. cerevisiae genome assemblies, clear signatures were found that defined each industrial class of yeast. This genetic variation was comprised of both single nucleotide polymorphisms and large-scale insertions and deletions, with the latter often being associated with ORF heterogeneity between strains. This included the discovery of more than twenty probable genes that had not been identified previously in the S. cerevisiae genome. Comparison of this large number of S. cerevisiae strains also enabled the characterization of a cluster of five ORFs that have integrated into the genomes of the wine and bioethanol strains on multiple occasions and at diverse genomic locations via what appears to involve the resolution of a circular DNA intermediate. This work suggests that, despite the scrutiny that has been directed at the yeast genome, there remains a significant reservoir of ORFs and novel modes of genetic transmission that may have significant phenotypic impact in this important model and industrial species.
Bioethanol is a biofuel produced mainly from the fermentation of carbohydrates derived from agricultural feedstocks by the yeast Saccharomyces cerevisiae. One of the most widely adopted strains is PE-2, a heterothallic diploid naturally adapted to the sugar cane fermentation process used in Brazil. Here we report the molecular genetic analysis of a PE-2 derived diploid (JAY270), and the complete genome sequence of a haploid derivative (JAY291). The JAY270 genome is highly heterozygous (approximately 2 SNPs/kb) and has several structural polymorphisms between homologous chromosomes. These chromosomal rearrangements are confined to the peripheral regions of the chromosomes, with breakpoints within repetitive DNA sequences. Despite its complex karyotype, this diploid, when sporulated, had a high frequency of viable spores. Hybrid diploids formed by outcrossing with the laboratory strain S288c also displayed good spore viability. Thus, the rearrangements that exist near the ends of chromosomes do not impair meiosis, as they do not span regions that contain essential genes. This observation is consistent with a model in which the peripheral regions of chromosomes represent plastic domains of the genome that are free to recombine ectopically and experiment with alternative structures. We also explored features of the JAY270 and JAY291 genomes that help explain their high adaptation to industrial environments, exhibiting desirable phenotypes such as high ethanol and cell mass production and high temperature and oxidative stress tolerance. The genomic manipulation of such strains could enable the creation of a new generation of industrial organisms, ideally suited for use as delivery vehicles for future bioenergy technologies.
Saccharomyces cerevisiae has been used for millennia in winemaking, but little is known about the selective forces acting on the wine yeast genome. We sequenced the complete genome of the diploid commercial wine yeast EC1118, resulting in an assembly of 31 scaffolds covering 97% of the S288c reference genome. The wine yeast differed strikingly from the other S. cerevisiae isolates in possessing 3 unique large regions, 2 of which were subtelomeric, the other being inserted within an EC1118 chromosome. These regions encompass 34 genes involved in key wine fermentation functions. Phylogeny and synteny analyses showed that 1 of these regions originated from a species closely related to the Saccharomyces genus, whereas the 2 other regions were of non-Saccharomyces origin. We identified Zygosaccharomyces bailii, a major contaminant of wine fermentations, as the donor species for 1 of these 2 regions. Although natural hybridization between Saccharomyces strains has been described, this report provides evidence that gene transfer may occur between Saccharomyces and non-Saccharomyces species. We show that the regions identified are frequent and differentially distributed among S. cerevisiae clades, being found almost exclusively in wine strains, suggesting acquisition through recent transfer events. Overall, these data show that the wine yeast genome is subject to constant remodeling through the contribution of exogenous genes. Our results suggest that these processes are favored by ecologic proximity and are involved in the molecular adaptation of wine yeasts to conditions of high sugar, low nitrogen, and high ethanol concentrations.
Many industrial strains of Saccharomyces cerevisiae have been selected primarily for their ability to convert sugars into ethanol efficiently despite exposure to a variety of stresses. To begin investigation of the genetic basis of phenotypic variation in industrial strains of S. cerevisiae, we have sequenced the genome of a wine yeast, AWRI1631, and have compared this sequence with both the laboratory strain S288c and the human pathogenic isolate YJM789. AWRI1631 was found to be substantially different from S288c and YJM789, especially at the level of single-nucleotide polymorphisms, which were present, on average, every 150 bp between all three strains. In addition, there were major differences in the arrangement and number of Ty elements between the strains, as well as several regions of DNA that were specific to AWRI1631 and that were predicted to encode proteins that are unique to this industrial strain.
We sequenced the genome of Saccharomyces cerevisiae strain YJM789, which was derived from a yeast isolated from the lung of an AIDS patient with pneumonia. The strain is used for studies of fungal infections and quantitative genetics because of its extensive phenotypic differences to the laboratory reference strain, including growth at high temperature and deadly virulence in mouse models. Here we show that the approximately 12-Mb genome of YJM789 contains approximately 60,000 SNPs and approximately 6,000 indels with respect to the reference S288c genome, leading to protein polymorphisms with a few known cases of phenotypic changes. Several ORFs are found to be unique to YJM789, some of which might have been acquired through horizontal transfer. Localized regions of high polymorphism density are scattered over the genome, in some cases spanning multiple ORFs and in others concentrated within single genes. The sequence of YJM789 contains clues to pathogenicity and spurs the development of more powerful approaches to dissecting the genetic basis of complex hereditary traits.
        
Title: Sequence analysis of the CEN12 region of Saccharomyces cerevisiae on a 43.7 kb fragment of chromosome XII including an open reading frame homologous to the human cystic fibrosis transmembrane conductance regulator protein CFTR Miosga T, Zimmermann FK Ref: Yeast, 12:693, 1996 : PubMed
In the framework of the European Union BIOTECH project for systematically sequencing the Saccharomyces cerevisiae genome, we determined the nucleotide sequence of a 43.7 kb DNA fragment spanning the centromeric region of chromosome XII. A novel approach was the distribution of sublibraries prepared by the DNA coordinator (J. Hoheisel, Heidelberg, FRG), using a new hybridization-based DNA mapping method, in order to facilitate ordered sequencing. The sequence contains 22 open reading frames (ORFs) longer than 299 bp, including the published sequences for ATS/DPS1, SCD25, SOF1, DRS1, MMM1, DNM1 and the centromeric region CEN12. Five putative ORF products show similarity to known proteins: the leucine zipper-containing ABC transporter L1313p to the yeast Ycflp metal resistance protein, to the yeast putative ATP-dependent permease Yhd5p, to the yeast putative proteins Yk83p and Yk84p, to the human cystic fibrosis transmembrane conductance regulator protein (hCFTR) and to the human multidrug resistance-associated protein hMRP1; L1325p to the Drosophila melanogaster Pumilio protein, to the putative yeast regulatory protein Yg13p and to the yeast protein Mpt5p/Htrlp; L1329p to human lipase A and gastric lipase, to rat lingual lipase and to the putative yeast triglyceride lipase Tg11p; L1341p to the putative yeast protein Yhg4p; and the leucine zipper-containing L1361p to the two yeast proteins 00953p and Ym8156.08p and to the Arabidopsis thaliana protein HYP1. Eight ORFs show no homology to known sequences in the database, three small ORFs are internal and complementary to larger ones and L1301 is complementary overlapping the ATS/DPS1 gene. Additionally three equally spaced ARS consensus sequences were found.
        
Title: DNM1, a dynamin-related gene, participates in endosomal trafficking in yeast Gammie AE, Kurihara LJ, Vallee RB, Rose MD Ref: Journal of Cell Biology, 130:553, 1995 : PubMed
We identified DNM1, a novel dynamin-related gene in Saccharomyces cerevisiae. Molecular and genetic mapping showed that DNM1 is the most proximal gene to the right of centromere 12, and is predicted to encode a protein of 85 kD, designated Dnm1p. The protein exhibits 41% overall identity with full-length dynamin I and 55% identity with the most highly conserved 400-amino acid GTPase region. Our findings show that like mammalian dynamin, Dnm1p participates in endocytosis; however, it is unlikely to be a cognate homologue. Cells with a disruption in the DNM1 gene showed mating response defects consistent with a delay in receptor-mediated endocytosis. The half-life of the Ste3p pheromone receptor was increased two- to threefold in the dnm1 mutant, demonstrating that Dnm1p participates in the constitutive turnover of the receptor. To define the step in the endocytic pathway at which Dnm1p acts, we analyzed mutant strains at both early and late steps of the process. Initial internalization of epitope-tagged pheromone receptor or of labeled pheromone proceeded with wild-type kinetics. However, delivery of the internalized receptor to the vacuole was greatly impeded during ligand-induced endocytosis. These data suggest that during receptor-mediated endocytosis, Dnm1p acts after internalization, but before fusion with the vacuole. The dnm1 mutant was not defective for sorting of vacuolar proteins, indicating that Dnm1p is not required for transport from the late endosome to the vacuole. Therefore, we suggest that Dnm1p participates at a novel step before fusion with the late endosome.
        
Title: MMM1 encodes a mitochondrial outer membrane protein essential for establishing and maintaining the structure of yeast mitochondria Burgess SM, Delannoy M, Jensen RE Ref: Journal of Cell Biology, 126:1375, 1994 : PubMed
In the yeast Saccharomyces cerevisiae, mitochondria are elongated organelles which form a reticulum around the cell periphery. To determine the mechanism by which mitochondrial shape is established and maintained, we screened yeast mutants for those defective in mitochondrial morphology. One of these mutants, mmm1, is temperature-sensitive for the external shape of its mitochondria. At the restrictive temperature, elongated mitochondria appear to quickly collapse into large, spherical organelles. Upon return to the permissive temperature, wild-type mitochondrial structure is restored. The morphology of other cellular organelles is not affected in mmm1 mutants, and mmm1 does not disrupt normal actin or tubulin organization. Cells disrupted in the MMM1 gene are inviable when grown on nonfermentable carbon sources and show abnormal mitochondrial morphology at all temperatures. The lethality of mmm1 mutants appears to result from the inability to segregate the aberrant-shaped mitochondria into daughter cells. Mitochondrial structure is therefore important for normal cell function. Mmm1p is located in the mitochondrial outer membrane, with a large carboxyl-terminal domain facing the cytosol. We propose that Mmm1p maintains mitochondria in an elongated shape by attaching the mitochondrion to an external framework, such as the cytoskeleton.
        
Title: A putative ATP-dependent RNA helicase involved in Saccharomyces cerevisiae ribosome assembly Ripmaster TL, Vaughn GP, Woolford JL, Jr. Ref: Proc Natl Acad Sci U S A, 89:11131, 1992 : PubMed
We have isolated a cold-sensitive mutant of Saccharomyces cerevisiae in which there is a deficit of 60S ribosomal subunits. Cold sensitivity and the assembly defect are recessive and cosegregate, defining a single essential gene that we designated DRS1 (deficiency of ribosomal subunits). The wild-type DRS1 gene was cloned by complementation of the cold-sensitive phenotype of drs1. Sequence analysis reveals a high degree of similarity to a family of proteins that are thought to function as ATP-dependent RNA helicases. Pulse-chase analysis of ribosomal RNA synthesis and processing indicates that the drs1 mutant accumulates the 27S precursor of the mature 25S rRNA. These results suggest that, as in pre-mRNA splicing, RNA helicase activities are involved in ribosomal RNA processing.