Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-YLL012W

Saccharomyces cerevisiae (Baker's yeast) chromosome xii yll012w Yeh1p Steryl ester hydrolase

Comment
Other strains: Saccharomyces cerevisiae (strains Lalvin EC1118 / Prise de mousse; Zymaflore VL3; YJM789; RM11-1a; VIN 13; AWRI1631; JAY291) Yeh1p


Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 6 more: Z73117, X91488, FN393078
>3 UniProt links 3 more: Q07804, C8ZCW1, A7A0P4
>3 UniProt links 3 more: Q07804, C8ZCW1, A7A0P4
>3 Interpro links 3 more: Q07804, C8ZCW1, A7A0P4
>3 Prodom links 3 more: Q07804, C8ZCW1, A7A0P4
>3 Pfam links 3 more: Q07804, C8ZCW1, A7A0P4
>3 PIRSF links 3 more: Q07804, C8ZCW1, A7A0P4
>3 SUPERFAM links 3 more: Q07804, C8ZCW1, A7A0P4
Sequence
Graphical view for this peptide sequence: yeast-YLL012W
Colored MSA for Acidic_Lipase (raw)
MGVSAVLKRARNLLATFIVCCFMAVVLVLALAHHFINEHRDTRSSSTQIE
VDDESKRNVHHDHVLTRTNAYATPYLDLEHDKKNGIVYDHTRTVVRKKNH
EVGSSSLHKNLFHKFLTKLIFRFIEKEKVTEGVTQGKFNNSSNEIANHEP
VFEKIPVQCDNPLQNLILSEDLTLVADLNYYFNQYNIQIEEFRLETEDGF
VIDLWHLIPKYRTTDSDKKKRPPILMLHGLLQSSGSFASNGRKSLAYFLY
QSGYDIWLGNNRCGFRPEWNEAKVPTLASRWDWDLREMVKYDLTLLIDTV
LAKTQFEKLTLISHSQGTTQGFMGLVNEDKFFPPGSGSKESFFTSKIANY
IALAPAVYPGPLLNEKLFVKLMTKEIENPWFFGETSFFEIMMIVRNLCVG
ESLFSFVCYTIFNYLFDWNDTLWDTALRDRHFLFSPVHVSVKLMQWWLSP
DPNKVSFKFGSHKMFPDNVKWFSDASKAPNIYLFVPKQDRLVDGERLINH
FVNVESNVNYKIWYIDEYAHIDVLWAHDVIERIGKPILQNLNNYYSKKPS
SAFESDCSDTEVETELEMVAEKA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVSAVLKRARNLLATFIVCCFMAVVLVLALAHHFINEHRDTRSSSTQIE
VDDESKRNVHHDHVLTRTNAYATPYLDLEHDKKNGIVYDHTRTVVRKKNH
EVGSSSLHKNLFHKFLTKLIFRFIEKEKVTEGVTQGKFNNSSNEIANHEP
VFEKIPVQCDNPLQNLILSEDLTLVADLNYYFNQYNIQIEEFRLETEDGF
VIDLWHLIPKYRTTDSDKKKRPPILMLHGLLQSSGSFASNGRKSLAYFLY
QSGYDIWLGNNRCGFRPEWNEAKVPTLASRWDWDLREMVKYDLTLLIDTV
LAKTQFEKLTLISHSQGTTQGFMGLVNEDKFFPPGSGSKESFFTSKIANY
IALAPAVYPGPLLNEKLFVKLMTKEIENPWFFGETSFFEIMMIVRNLCVG
ESLFSFVCYTIFNYLFDWNDTLWDTALRDRHFLFSPVHVSVKLMQWWLSP
DPNKVSFKFGSHKMFPDNVKWFSDASKAPNIYLFVPKQDRLVDGERLINH
FVNVESNVNYKIWYIDEYAHIDVLWAHDVIERIGKPILQNLNNYYSKKPS
SAFESDCSDTEVETELEMVAEKA


References
6 more
    Title: Sequence analysis of the CEN12 region of Saccharomyces cerevisiae on a 43.7 kb fragment of chromosome XII including an open reading frame homologous to the human cystic fibrosis transmembrane conductance regulator protein CFTR
    Miosga T, Zimmermann FK
    Ref: Yeast, 12:693, 1996 : PubMed

            

    Title: MMM1 encodes a mitochondrial outer membrane protein essential for establishing and maintaining the structure of yeast mitochondria
    Burgess SM, Delannoy M, Jensen RE
    Ref: Journal of Cell Biology, 126:1375, 1994 : PubMed

            

    Title: A putative ATP-dependent RNA helicase involved in Saccharomyces cerevisiae ribosome assembly
    Ripmaster TL, Vaughn GP, Woolford JL, Jr.
    Ref: Proc Natl Acad Sci U S A, 89:11131, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer