leibr-a4hen1

Leishmania braziliensis Putative uncharacterized protein

Comment

Relationship

Family : LIDHydrolase

Block : X

Position in NCBI Life Tree : Leishmania braziliensis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSSPNTIVAWKAPVAGGVVVDVLQSSSNLLQYLTTVESSN
GGCELPNSNR KLLVFFPGNPGLVQFYEPMCACLEKNKFD
VLVMGYAGHSLTQLNKGRVFS LAEQMDIADSFVATLINK
NTELKYKKNIYVGGHSIGGFVALQMGARYASI KKCFGLC
PVISHLRDSPNGRRLFYLSNTVTQCCVAMGAALLELLPYK
LRH LLIARWEPKLSPALAEALAHHCHRWCLMNSLYMAMT
EFRMLLQPDAVLLR HVQERLILYYVQNDGWAPLSYAEEI
KRICPQLGAYVLEEDAGVPHAWCLD RSETVVRNAILKHC