renre-luc

Renilla reniformis luciferase , luciferin 2-monooxygenase

Comment

"Luciferase from Renilla reniformis (RLuc) catalyzes the degradation of coelenterazine in the presence of molecular oxygen, resulting in the product coelenteramide, carbon dioxide, and the desired photon of light (EC 1.13.12.5). This enzyme belongs to the Haloalkane dehalogenase family II with a different catalytic function (EC 3.8.1.5) Reconstruction of an ancestral enzyme shows it has both hydrolase and monooxygenase activities ( Chaloupkova et al.<\/A>). This luciferase produces light with a wavelength of 480 nm. In presence of a green fluorescence protein (GFP) it produces a green fluorescence at 509 nm. It is different of most other luciferases which are not alpha Beta hydrolases"

Molecular evidence

No mutation

No kinetic

No disease

Database

Sequence

Peptide

MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSE
KHAENAVIFL HGNAASSYLWRHVVPHIEPVARCIIPDLI
GMGKSGKSGNGSYRLLDHYKY LTAWFELLNLPKKIIFVG
HDWGACLAFHYSYEHQDKIKAIVHAESVVDVI ESWDEWP
DIEEDIALIKSEEGEKMVLENNFFVETMLPSKIMRKLEPE
EFA AYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQI
VRNYNAYLRASDDL PKMFIESDPGFFSNAIVEGAKKFPN
TEFVKVKGLHFSQEDAPDEMGKYIK SFVERVLKNEQ

References

Title : Uncovering the role of sorbitol in Renilla luciferase kinetics: Insights from spectroscopic and molecular dynamics studies - Khoshnevisan_2024_Biochem.Biophys.Rep_37_101617
Author(s) : Khoshnevisan G , Emamzadeh R , Nazari M , Oliayi M , Sariri R
Ref : Biochem Biophys Rep , 37 :101617 , 2024
Abstract : Khoshnevisan_2024_Biochem.Biophys.Rep_37_101617
ESTHER : Khoshnevisan_2024_Biochem.Biophys.Rep_37_101617
PubMedSearch : Khoshnevisan_2024_Biochem.Biophys.Rep_37_101617
PubMedID: 38371529
Gene_locus related to this paper: renre-luc

Title : Catalytic mechanism for Renilla-type luciferases - Schenkmayerova_2023_Nat.Catal_6_23
Author(s) : Schenkmayerova A , Toul M , Pluskal D , Baatallah R , Gagnot G , Pinto GP , Santana VT , Stuchla M , Neugebauer P , Chaiyen P , Damborsky J , Bednar D , Janin YL , Prokop Z , Marek M
Ref : Nature Catalysis , 6 :23 , 2023
Abstract : Schenkmayerova_2023_Nat.Catal_6_23
ESTHER : Schenkmayerova_2023_Nat.Catal_6_23
PubMedSearch : Schenkmayerova_2023_Nat.Catal_6_23
PubMedID:
Gene_locus related to this paper: 9zzzz-AncHLDRLuc2 , renre-luc

Title : Deciphering Enzyme Mechanisms with Engineered Ancestors and Substrate Analogues - Gao_2023_ChemCatChem_15_e202300745
Author(s) : Gao T , Damborsky J , Janin YL , Marek M
Ref : ChemCatChem , 15 :e202300745 , 2023
Abstract : Gao_2023_ChemCatChem_15_e202300745
ESTHER : Gao_2023_ChemCatChem_15_e202300745
PubMedSearch : Gao_2023_ChemCatChem_15_e202300745
PubMedID:
Gene_locus related to this paper: renre-luc

Title : A catalytic mechanism for Renilla-type bioluminescence - Schenkmayerova_2022_Biorxiv__
Author(s) : Schenkmayerova A , Toul M , Pluskal D , Baatallah R , Gagnot G , Pinto GP , Santana VT , Stuchla M , Neugebauer P , Chaiyen P , Damborsky J , Bednar D , Janin YL , Prokop Z , Marek M
Ref : Biorxiv , : , 2022
Abstract : Schenkmayerova_2022_Biorxiv__
ESTHER : Schenkmayerova_2022_Biorxiv__
PubMedSearch : Schenkmayerova_2022_Biorxiv__
PubMedID:
Gene_locus related to this paper: 9zzzz-AncHLDRLuc2 , renre-luc

Title : Engineering the protein dynamics of an ancestral luciferase - Schenkmayerova_2021_Nat.Commun_12_3616
Author(s) : Schenkmayerova A , Pinto GP , Toul M , Marek M , Hernychova L , Planas-Iglesias J , Daniel Liskova V , Pluskal D , Vasina M , Emond S , Dorr M , Chaloupkova R , Bednar D , Prokop Z , Hollfelder F , Bornscheuer UT , Damborsky J
Ref : Nat Commun , 12 :3616 , 2021
Abstract : Schenkmayerova_2021_Nat.Commun_12_3616
ESTHER : Schenkmayerova_2021_Nat.Commun_12_3616
PubMedSearch : Schenkmayerova_2021_Nat.Commun_12_3616
PubMedID: 34127663
Gene_locus related to this paper: renre-luc

Title : Engineering Protein Dynamics of Ancestral Luciferase - Schenkmayerova_2020_Chemrxiv__
Author(s) : Schenkmayerova A , Pinto GP , Toul M , Marek M , Hernychova L , Planas-Iglesias J , Liskova V , Pluskal D , Vasina M , Emond S , Dorr M , Chaloupkova R , Bednar D , Prokop Z , Hollfelder F , Bornscheuer UT , Damborsky J
Ref : Chemrxiv , : , 2020
Abstract : Schenkmayerova_2020_Chemrxiv__
ESTHER : Schenkmayerova_2020_Chemrxiv__
PubMedSearch : Schenkmayerova_2020_Chemrxiv__
PubMedID:
Gene_locus related to this paper: renre-luc

Title : Light-Emitting Dehalogenases: Reconstruction of Multifunctional Biocatalysts - Chaloupkova_2019_ACS.Catal_9_48103
Author(s) : Chaloupkova, R , Liskova V , Tool M , Markova K , Sebestova E , Hernychova L , Marek M , Pinto GP , Pluskal D , Waterman J , Prokop Z , Damborsky J
Ref : ACS Catal , 9 :4810 , 2019
Abstract : Chaloupkova_2019_ACS.Catal_9_48103
ESTHER : Chaloupkova_2019_ACS.Catal_9_48103
PubMedSearch : Chaloupkova_2019_ACS.Catal_9_48103
PubMedID:
Gene_locus related to this paper: 9zzzz-AncHLDRLuc2 , 9zzzz-AncHLDRLuc , renre-luc

Title : Probing the emitter site of Renilla luciferase using small organic molecules\; an attempt to understand the molecular architecture of the emitter site - Salehi_2016_Int.J.Biol.Macromol_93_1253
Author(s) : Salehi F , Emamzadeh R , Nazari M , Rasa SM
Ref : Int J Biol Macromol , 93 :1253 , 2016
Abstract : Salehi_2016_Int.J.Biol.Macromol_93_1253
ESTHER : Salehi_2016_Int.J.Biol.Macromol_93_1253
PubMedSearch : Salehi_2016_Int.J.Biol.Macromol_93_1253
PubMedID: 27651278
Gene_locus related to this paper: renre-luc

Title : Understanding the molecular behaviour of Renilla luciferase in imidazolium-based ionic liquids, a new model for the alpha\/beta fold collapse - Ghaedizadeh_2016_Biochem.Eng.J_105_505
Author(s) : Ghaedizadeh S , Emamzadeh R , Nazari M , Rasa SMM , Zarkesh-Esfahani SH , Yousefi M
Ref : Biochem Eng J , 105 :505 , 2016
Abstract : Ghaedizadeh_2016_Biochem.Eng.J_105_505
ESTHER : Ghaedizadeh_2016_Biochem.Eng.J_105_505
PubMedSearch : Ghaedizadeh_2016_Biochem.Eng.J_105_505
PubMedID:
Gene_locus related to this paper: renre-luc

Title : Structure-function studies on the active site of the coelenterazine-dependent luciferase from Renilla - Woo_2008_Protein.Sci_17_725
Author(s) : Woo J , Howell MH , von Arnim AG
Ref : Protein Science , 17 :725 , 2008
Abstract : Woo_2008_Protein.Sci_17_725
ESTHER : Woo_2008_Protein.Sci_17_725
PubMedSearch : Woo_2008_Protein.Sci_17_725
PubMedID: 18359861
Gene_locus related to this paper: renre-luc

Title : Crystal structures of the luciferase and green fluorescent protein from Renilla reniformis - Loening_2007_J.Mol.Biol_374_1017
Author(s) : Loening AM , Fenn TD , Gambhir SS
Ref : Journal of Molecular Biology , 374 :1017 , 2007
Abstract : Loening_2007_J.Mol.Biol_374_1017
ESTHER : Loening_2007_J.Mol.Biol_374_1017
PubMedSearch : Loening_2007_J.Mol.Biol_374_1017
PubMedID: 17980388
Gene_locus related to this paper: renre-luc

Title : Consensus guided mutagenesis of Renilla luciferase yields enhanced stability and light output - Loening_2006_Protein.Eng.Des.Sel_19_391
Author(s) : Loening AM , Fenn TD , Wu AM , Gambhir SS
Ref : Protein Engineering Des Sel , 19 :391 , 2006
Abstract : Loening_2006_Protein.Eng.Des.Sel_19_391
ESTHER : Loening_2006_Protein.Eng.Des.Sel_19_391
PubMedSearch : Loening_2006_Protein.Eng.Des.Sel_19_391
PubMedID: 16857694
Gene_locus related to this paper: renre-luc

Title : Bifunctional antibody-Renilla luciferase fusion protein for in vivo optical detection of tumors - Venisnik_2006_Protein.Eng.Des.Sel_19_453
Author(s) : Venisnik KM , Olafsen T , Loening AM , Iyer M , Gambhir SS , Wu AM
Ref : Protein Engineering Des Sel , 19 :453 , 2006
Abstract : Venisnik_2006_Protein.Eng.Des.Sel_19_453
ESTHER : Venisnik_2006_Protein.Eng.Des.Sel_19_453
PubMedSearch : Venisnik_2006_Protein.Eng.Des.Sel_19_453
PubMedID: 16882674
Gene_locus related to this paper: renre-luc

Title : Isolation and expression of a cDNA encoding Renilla reniformis luciferase - Lorenz_1991_Proc.Natl.Acad.Sci.U.S.A_88_4438
Author(s) : Lorenz WW , McCann RO , Longiaru M , Cormier MJ
Ref : Proceedings of the National Academy of Sciences of the United States of America , 88 :4438 , 1991
Abstract : Lorenz_1991_Proc.Natl.Acad.Sci.U.S.A_88_4438
ESTHER : Lorenz_1991_Proc.Natl.Acad.Sci.U.S.A_88_4438
PubMedSearch : Lorenz_1991_Proc.Natl.Acad.Sci.U.S.A_88_4438
PubMedID: 1674607
Gene_locus related to this paper: renre-luc

Title : Purification and properties of Renilla reniformis luciferase - Matthews_1977_Biochemistry_16_85
Author(s) : Matthews JC , Hori K , Cormier MJ
Ref : Biochemistry , 16 :85 , 1977
Abstract : Matthews_1977_Biochemistry_16_85
ESTHER : Matthews_1977_Biochemistry_16_85
PubMedSearch : Matthews_1977_Biochemistry_16_85
PubMedID: 12797
Gene_locus related to this paper: renre-luc