vibch-a6xrz3

Vibrio cholerae (strains AM-19226; V51) Vibrio mimicus VM603 Putative uncharacterized protein

Comment

Relationship

Family : 6_AlphaBeta_hydrolase

Block : X

Position in NCBI Life Tree : Vibrio cholerae AM-19226

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MKYFQKGSGEYLVLVHGALTDGSMWLPHVDSLAQYFDVVS
VTLSHFDNDD NLSFGLNSHAQELCGLVQQLVSEKPVNVV
GWSYGADVVLNMIATSQLPLS KVFLYELGYPGCVQEDEM
STWVADANSMFEPVFNHVHQGNLSLAVESLID GSGNCQG
YFDKQATEIKSLQLKQAYTLPLQLNQQERPSIDVQSLSNI
ELS LIFGYGDKTRDLFKLATQSDARASRCSKLVVIENES
HMLPQENPEKFSSL LIEFLGKKG