vibcb-a7mwv0

Vibrio harveyi, Putative uncharacterized protein

Comment

"Other strains: Vibrio harveyi (strain ATCC BAA-1116 \/ BB120\; 1DA3\; HY01) Putative uncharacterized protein"

Relationship

Family : Duf_1100-R

Block : X

Position in NCBI Life Tree : Vibrio harveyi

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSEDVSKNLSETLFVKHKQAKETSALTQYMPTSQKILDER
EEHGERAWYR HLRRLQWVWQGLSPIEMEAVLAKIASSKH
SRTEDKWLDTVMGYHSGNWAF EWIKLGMEHQRRSNEMKG
EEAADELFTASLCFSIAGYPHLKNDNLATQAQ VLANKAY
TEGSEKTQYVIKQIEIPYQKRKIIANLHLPRTDKQLPVVM
VSA GLDSLQTDMWRLFRNHLAPKDIAMLTIDMPSVGHSS
HWPLTENSSCLHQA VLNELFSLPWVDHHKVGLIGFRFGG
NAMIRLSFVEQEKIKACVALGAPVH DVFTSPKKLQQMPK
MYLDLLASRLGKNAVDINSMAGQMMAWSLKVQGFLT SRK
TKVPILALSLEGDPVSPHSDNQLVALFSQYGQAKKISSKT
ITKGYEQ SLDLAIKWLEEELLR