vibal-q1v7d0

Vibrio alginolyticus (strains 12G01; 40B) Vibrio sp. (strain Ex25) putative esterase

Comment

Relationship

Family : A85-EsteraseD-FGH

Block : X

Position in NCBI Life Tree : Vibrio alginolyticus 12G01

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MTIENVSQAKVFGGWHKQYTHESNALNCTMRFAIFLPPNA
TKSNPVPALY WLSGLTCTDENFMQKAGAFRMAAELGIAI
IAPDTSPRGEGIADDESYDLG KGAGFYLNATQAPWSLHY
CMYDYVTEELPAIIESNFPVSDVKSISGHSMG GHGALTI
GLKNSEQYRSISAFSPISNPMQCPWGQKAFTAYLGKELES
WKQ YDASELLKQQQSPLPILVDQGDADGFLNEQLRPEAL
IAAAKIHDSNLTLR MQPGYDHSYYFISSFIEEHLNFHAK
YLFA