vibal-q1v463

Vibrio alginolyticus (12G01; 40B) hypothetical protein

Comment

Relationship

Family : MenH_SHCHC

Block : X

Position in NCBI Life Tree : Vibrio alginolyticus

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MLYFERFPVLEKHQSRTLPTLVFLHGLLGSGADWLACLNA
LPEYERVTVD LPGHGHSQSISCSDLNDCCKLLGSTLSLL
FPSQQPLILIGYSMGGRIAMH GIAHQCFPDLNIAGAIIE
GGNFGLQTESEKQVRLENDARWAMRFKTEPLE RVLNDWY
QQAVFSSLNHEQRQTFIAKRSDNLGSAVANMLMTTSLAKQ
AYL LPSLQKQNIPVYYLCGEKDQKFSQLAQRSGLAYRQV
EGAGHNVHQEQPKQ FAIHTKQIIQSHFGESNENNGNHHG