vibha-d0x7p9

Vibrio harveyi 1DA3 Putative uncharacterized protein

Comment

Relationship

Family : A85-IroE-IroD-Fes-Yiel

Block : X

Position in NCBI Life Tree : Vibrio harveyi 1DA3

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MEVLKRWFIALSLGLVLSACGGSDGSGVDSSTSDNNLNQI
QASIFSNITG VTYPYDVYLPENYEDRLTSLPVIFVSDGG
GTGLSFAELIDDYGAEVILVA VHEGPPGRRDIDYLPPGV
DDYYLFLTQELIPIVEAEYDIDPTQRTLAGHS FGGAKSA
YVMLTEDFGAEFFSNFIISDGSFWRIEDTIYPIEEERYLI
SPW LEVTAIFSATSGRTGNFYWVDIFYSHIKSKEYQGFT
LPPLIHYNGLNHGV MWYHTYRDSLPILFPKEEI