vibha-d0xda8

Vibrio harveyi; Vibrio sp. Uncharacterized protein

Comment

"Other strains: Vibrio harveyi 1DA3\; Vibrio sp. HENC-03"

Relationship

Family : NLS3-Tex30

Block : X

Position in NCBI Life Tree : Vibrio harveyi 1DA3

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSHWIVEGPENGPLFIFAHGAGAGMEHDFMSAVAKGLVEQ
GIRVVRFNFP YMVKRAEDGKKRPPDRAPKLLEAYEEVIT
HFASQPIVIGGKSMGGRMSSL LADNELVAGIACLGFPFH
PPGKPEKYKGEHLANIEKPTLILQGERDTFGK REEFDGF
ALSEQVQVRFLPDGDHSFKPRKSSGYTEAGNIASTVEQLA
AFI KEVYREK