vibal-q1vfw6

Vibrio alginolyticus, Vibrio harveyi, Vibrio sp., putative prolyl aminopeptidase

Comment

"Other strains: Vibrio alginolyticus 12G01 Vibrio harveyi (1DA3\; HY01), Vibrio sp. (strain Ex25)"

Relationship

Family : Proline_iminopeptidase

Block : X

Position in NCBI Life Tree : Vibrio alginolyticus 12G01

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MNAQSFIDAGLHYTPHSFTVPLDYQNASKGTIEVFARAVC
LVGEEESTKP WLVYFQGGPGFPSPRQNGNNGWVKRALQE
YRVLLLDQRGTGNSSVINHQT LAHLTPEQQADYLSHFRA
DNIVRDAEYIREQFGVEKWAILGQSFGGFCSL TYLSLFP
DSLLQSYITGGVPSVSRHADDVYEATFKRTMEKNQAFFQQ
FPN AQQLCQNIANHLLENEEYLPNGQRFTVEQFQQIGIN
FGVSDTFLPTYYWL ESALIEVNGKPQLRYEFLNDMLAQQ
NFQTNPIYAILHESIYCQSFASNWS AHRVRQTRSEFNYE
SGKPFYFTGEMVFPWMFDQYVNLKPLKDAAEILAAK KDW
TALYDQTQLAQNKVPVSCAVYADDMFVEMDISRETLALIP
NSKAWIT NEYEHNGLRADGERILDRLIAMGKQTAAALK