vibha-d0xgc5

Vibrio harveyi 1DA3 Putative uncharacterized protein

Comment

"only c-term Pfam A Abhydrolase_6 366 618 n-term patatin"

Relationship

Family : Monoglyceridelipase_lysophospholip

Block : X

Position in NCBI Life Tree : Vibrio harveyi 1DA3

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

VIVQGRNESFWKYKEVIYELSQYFNIYSFDHRGQGESQRL
AEHSELGHVD QFEHYVEDLAQFLEEVVESQHKDEVMMLA
HSMGGAVATQYLASYDHNVKA CALTSPMFGIKLPKVVGG
IQTATIKLISQLQKTPNFAPTQTAFVTKTFEG NDHTSSP
NRFKAYSDLLSNHPNLRLGGVSPKWISEAVAAGKNCLAQA
KDI KTPILIVQPEGDNVVSLPAQDLFNEHCASSRLLSIP
HARHDILIESDRYR DWALKRIMNFYDHSHKFV