9vibr-k5u9q4

Vibrio sp.; Vibrio harveyi, Uncharacterized protein

Comment

"Other strains: Vibrio sp. HENC-03\; Vibrio harveyi 1DA3"

Relationship

Family : abh_upf00227

Block : X

Position in NCBI Life Tree : Vibrio sp. HENC-03

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSKPSLLLYIHGFNSSPLSMKANLMKAFCEQQRPDIKVIV
PQLPCFPQLA AQCLLEIVEQYKDDYNIGLVGSSLGGYMS
TWLNAKFGFPAVVVNPAVKPY ELLVDYLGEQTNPYTHET
YTLEACHIDELKALDVQSIASPESFWLLQQTE DEVLDYR
QAVEKFVNAKQTVEEGGDHSFVGFERYPAQIIEFLKL