vibmi-d2y908

Vibrio mimicus VM603 Putative uncharacterized protein

Comment

Relationship

Family : Duf_900

Block : X

Position in NCBI Life Tree : Vibrio mimicus VM603

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MLKSCPERIQSSLEKVIIKSIDFEPELHFEHTTVFYATNR
DGVGGKLHFG RGRSNEMHYGIVDVSIPISHVSGEVERPL
ELFRVSFGKENKRKHITIERG QRLDKGEFLSVLSHSSRK
QSVMLFIHGYNVNFNDAIYKSAQIKYDLNYEY PLVLFSW
PSQGSLLGYVADKEQAFYSSSFLAELLCDISNLGIDEVLV
LAH SMGSLCLAEAIKKINSSSPLLSKLALAAPDIQKQEF
LQEYSTYIKTAFDE VTLYVSSKGKALWCSKYANSAVRLG
DAGENITVIDGVDTIDMSEVDRGLF SLNHSYISEKNSAM
TDMHNFFINSIPARLRRLKSKLTRDRDEYWAMYGD