xentr-b0bmb8

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Lipc protein

Comment

Relationship

Family : Hepatic_Lipase

Block : L

Position in NCBI Life Tree : Xenopus tropicalis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MGRMQLLPLLLILLLTEQTLTQKGKQKCKEEEHAMATRIK
KHQDIPETKF KLYEEGRDEDLCQIQIFQPETLEKCSFNE
SLPLVIIIHGWSVDGMLESWI WKMASAFKSQKRQVNVIV
ADWLTFAHVHYPIAVQNTRIIGLEIAEFLEWL ESSIQFP
RSNIHLIGYSLGAHVSGFAGSYISGLKKIGRITGLDPAGP
LFE GMSSTDRLSPDDANFVDAIHTFTQQHMGLSVGINQP
VAHYDFYPNGGHFQ PGCDIKNLIANIGFYGIKETVKCAH
ERSVHLFIDSLLNDDKQSMAYWCKD INTFDKGVCLSCRK
NRCNTLGYNIKKKRLQRAKKLFLKTRSNMPYKVYHY QFK
INFIHQTKDMQLDPTFTITLIGTKEDVENVPFTPADGIKG
NKTHSFL ITLETDIGELMMIKFKWEGVDVWANIWDTVQT
IMPWTSEADRPGLLVNII RVKAGETQEQMTFCSENVDNI
KLLPGQEKTYVRCKNNVKVKKARTS

References

Title : The genome of the Western clawed frog Xenopus tropicalis - Hellsten_2010_Science_328_633
Author(s) : Hellsten U , Harland RM , Gilchrist MJ , Hendrix D , Jurka J , Kapitonov V , Ovcharenko I , Putnam NH , Shu S , Taher L , Blitz IL , Blumberg B , Dichmann DS , Dubchak I , Amaya E , Detter JC , Fletcher R , Gerhard DS , Goodstein D , Graves T , Grigoriev IV , Grimwood J , Kawashima T , Lindquist E , Lucas SM , Mead PE , Mitros T , Ogino H , Ohta Y , Poliakov AV , Pollet N , Robert J , Salamov A , Sater AK , Schmutz J , Terry A , Vize PD , Warren WC , Wells D , Wills A , Wilson RK , Zimmerman LB , Zorn AM , Grainger R , Grammer T , Khokha MK , Richardson PM , Rokhsar DS
Ref : Science , 328 :633 , 2010
Abstract : Hellsten_2010_Science_328_633
ESTHER : Hellsten_2010_Science_328_633
PubMedSearch : Hellsten_2010_Science_328_633
PubMedID: 20431018
Gene_locus related to this paper: xenla-q6pcj9 , xentr-a9umk0 , xentr-abhdb , xentr-ACHE , xentr-b0bm77 , xentr-b1h0y7 , xentr-b2guc4 , xentr-b7zt03 , xentr-b7ztj4 , xentr-BCHE1 , xentr-BCHE2 , xentr-cxest2 , xentr-d2x2k4 , xentr-d2x2k6 , xentr-f6rff6 , xentr-f6v0g3 , xentr-f6v2j6 , xentr-f6v3z1 , xentr-f6y4c8 , xentr-f6yve5 , xentr-f7a4y9 , xentr-f7acc5 , xentr-f7e2e2 , xentr-LOC394897 , xentr-ndrg1 , xentr-q0vfb6 , xentr-f7cpl7 , xentr-f6yj44 , xentr-f7ejk4 , xentr-f6q8j8 , xentr-f6z8f0 , xentr-f7d709 , xentr-b0bmb8 , xentr-f7af63 , xentr-a0a1b8y2w9 , xentr-f7d4k9 , xentr-f6r032 , xentr-f6yvq3 , xentr-a0a1b8y2z3 , xentr-f7afg4 , xentr-f6xb15 , xentr-f7e1r2 , xentr-a4ihf1 , xentr-f7eue5 , xentr-f6u7u3 , xentr-f172a , xentr-f7equ8 , xentr-f7dd89 , xentr-a9jtx5