Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspcl-a1cc86

Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCT 3887 / NRRL 1) Siderophore biosynthesis lipase/esterase, putative

Relationship
Family|Duf_1749
Block| X
Position in NCBI Life Tree|Aspergillus clavatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus clavatus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DS027050
1 UniProt : A1CC86
1 UniProt : A1CC86
1 Interpro : A1CC86
1 Prodom : A1CC86
1 Pfam : A1CC86
1 PIRSF : A1CC86
1 SUPERFAM : A1CC86
Sequence
Graphical view for this peptide sequence: aspcl-a1cc86
Colored MSA for Duf_1749 (raw)
MYSKFWPKGGLQGILHHYTETLVTFEYTTGTIRKPNSVLFVGGLGDGLAT
TSYMADLVHALQPTDWSIFTLNLTSSYQSWGLGHLDRDTNEIARCLQYIK
EYKTEKFGQGKIVLMGHSTGSQCVVHYLSRPNPHTEIPSFDSDIEHIVRP
PLDGAIMQAPVSDREAILWVLSEGIGGKTGAEVREIYEKVEAMAKQAVRD
DKTGSDVLLPLSMTGQVGYPGNTPLSCRRFLSLTSPDSPQAPAEDDLFSS
DLSDEHLKTTFGMIHPRGLLRGKLMVLESGADQSVPSWVNKKELLERWRN
AANHNGKVDLWDQEHSAIIPNASHALSNDDQAEPRKFLVEKVMGYLRTFE
KA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYSKFWPKGGLQGILHHYTETLVTFEYTTGTIRKPNSVLFVGGLGDGLAT
TSYMADLVHALQPTDWSIFTLNLTSSYQSWGLGHLDRDTNEIARCLQYIK
EYKTEKFGQGKIVLMGHSTGSQCVVHYLSRPNPHTEIPSFDSDIEHIVRP
PLDGAIMQAPVSDREAILWVLSEGIGGKTGAEVREIYEKVEAMAKQAVRD
DKTGSDVLLPLSMTGQVGYPGNTPLSCRRFLSLTSPDSPQAPAEDDLFSS
DLSDEHLKTTFGMIHPRGLLRGKLMVLESGADQSVPSWVNKKELLERWRN
AANHNGKVDLWDQEHSAIIPNASHALSNDDQAEPRKFLVEKVMGYLRTFE
KA


Reference
    Title: Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus
    Fedorova ND, Khaldi N, Joardar VS, Maiti R, Amedeo P, Anderson MJ, Crabtree J, Silva JC, Badger JH and Nierman WC <29 more author(s)>
    Ref: PLoS Genet, 4:e1000046, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer