aspfu-q4wf29

 
Aspergillus fumigatus Af293 and Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus) Siderophore esterase IroE-like AfEstB

Comment
(from UniProtKB) Displays specific TAFC esterase activity but does not hydrolyze fusarinine C, which has the same core structure as TAFC. Hydrolysis optimizes but is not essential for TAFC-mediated iron uptake.Both extra- and intracellular siderophores have been shown to be crucial for the virulence. Subsequent to chelation of iron and uptake, FsC and TAFC are hydrolyzed and the iron is transferred to the metabolism or to the intracellular siderophore ferricrocin (FC) for transport and storage of iron. Hydrolyzes both TAFC and DF-TAFC with equal efficiencies, suggesting that its function might not be restricted to the release of iron from the siderophore but might also include the degradation of the iron-free chelator to protect cells Kargl et al.


Relationship
Block X
Aspergillus fumigatus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
5 structures (e.g. : 6GUD, 6GUG, 6GUI... more)
No kinetic

Substrate: Triacetylfusigen ,

2 Genbank : AAHF01000010, DS499596
2 UniProt : Q4WF29, B0XZL7
>3 Structure links 2 more: 6GUD, 6GUG, 6GUI
2 UniProtTrembl : Q4WF29, B0XZL7
2 Interpro : Q4WF29, B0XZL7
2 Prodom : Q4WF29, B0XZL7
2 Pfam : Q4WF29, B0XZL7
2 PIRSF : Q4WF29, B0XZL7
2 SUPERFAM : Q4WF29, B0XZL7
2 QuickSwissBlast : Q4WF29, B0XZL7
 
Sequence
Graphical view for this peptide sequence: aspfu-q4wf29
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MGDRPTPVPLPNSEQFYLENDRGEPYLIQVSWPLHWEDKQTGRGPLPIIY
IVDGNALFLTATEAAWRRAAASHFAGGGIIVAIGYPLKGKLYDARRRSFD
LTPPTACAPVGYGGADVFLDFIENSVRPAVQARFPQVSLAREALYGHSYG
GLLALHALFTRPQSFDCYIASSPSIWWNSLCILHEAKAFVETKKVSHDQS
PSLMVSWGSWEQHPPRWADELLDHYEARKRTAAELRMADNALDLCAMLHG
CSRLHALIKTEYEGEDHTSVMSCSVSRGLTMFFEDWPFHQSG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGDRPTPVPLPNSEQFYLENDRGEPYLIQVSWPLHWEDKQTGRGPLPIIY
IVDGNALFLTATEAAWRRAAASHFAGGGIIVAIGYPLKGKLYDARRRSFD
LTPPTACAPVGYGGADVFLDFIENSVRPAVQARFPQVSLAREALYGHSYG
GLLALHALFTRPQSFDCYIASSPSIWWNSLCILHEAKAFVETKKVSHDQS
PSLMVSWGSWEQHPPRWADELLDHYEARKRTAAELRMADNALDLCAMLHG
CSRLHALIKTEYEGEDHTSVMSCSVSRGLTMFFEDWPFHQSG

no DNA




References
    Title: Iron Scavenging in Aspergillus Species: Structural and Biochemical Insights into Fungal Siderophore Esterases
    Ecker F, Haas H, Groll M, Huber EM
    Ref: Angew Chem Int Ed Engl, 57:14624, 2018 : PubMed

            

    Title: Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus
    Fedorova ND, Khaldi N, Joardar VS, Maiti R, Amedeo P, Anderson MJ, Crabtree J, Silva JC, Badger JH and Nierman WC <29 more author(s)>
    Ref: PLoS Genet, 4:e1000046, 2008 : PubMed

            

    Title: EstB-mediated hydrolysis of the siderophore triacetylfusarinine C optimizes iron uptake of Aspergillus fumigatus
    Kragl C, Schrettl M, Abt B, Sarg B, Lindner HH, Haas H
    Ref: Eukaryot Cell, 6:1278, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer