Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bommo-a9ls22

Bombyx mori (Silk moth) Carboxylesterase-6

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Bombyx mori
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Bombycoidea: N E > Bombycidae: N E > Bombycinae: N E > Bombyx: N E > Bombyx mori: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : EU255790, NP_001104822, ABX46627
2 UniProt : A9LS22, H9JN84
2 UniProt : A9LS22, H9JN84
2 Interpro : A9LS22, H9JN84
2 Prodom : A9LS22, H9JN84
2 Pfam : A9LS22, H9JN84
2 PIRSF : A9LS22, H9JN84
2 SUPERFAM : A9LS22, H9JN84
Sequence
Graphical view for this peptide sequence: bommo-a9ls22
Colored MSA for Carb_B_Arthropoda (raw)
MVKVKVTQGWLEGEVLETVTGYRKYYSFKGIPYAEPPLGKLRFKAPRPAL
PWEGVKKATQHGPVCPQVDIFTEILIPGSEDCLYLNVYTPEINSETLLPV
MFFIHGGGYKSGSGNVDNYGPDFLVAHGIILVTINYRLDALGFLCLDTEE
VPGNAGMKDQVAALKWVKENISSFGGDPDNITVFGESAGGASTSFHVISP
MSKGLFKRVISMSGVLFCDWSIAFEPRRRAFKLGQLLGIETENPDELLEY
LQNVPVEKLVNTDPNIITMEELHKNMLKFYHFTPVVEKDFGQEHFLTREP
IEVLKHGNINDVDMLLGFTNEEAIIGITLLEKHLVHLYNKYIDLFAPRLI
TIKATPDKVLEISDRIRHFYFGNKKVNLESMREFVTFVNDCGFIYPIHRF
AGKLSDLINTKVFMYKFSMFSNRNVYGAAGANYKITGASHLEDLMYLFDA
KKFDLKIETTSREYRLINLACTIFTNFAKFGNPTPDTSLGVKWPEYNKET
RKYCDIGDELTIGLDNYRQTVDFWKKVYEDAGLEF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVKVKVTQGWLEGEVLETVTGYRKYYSFKGIPYAEPPLGKLRFKAPRPAL
PWEGVKKATQHGPVCPQVDIFTEILIPGSEDCLYLNVYTPEINSETLLPV
MFFIHGGGYKSGSGNVDNYGPDFLVAHGIILVTINYRLDALGFLCLDTEE
VPGNAGMKDQVAALKWVKENISSFGGDPDNITVFGESAGGASTSFHVISP
MSKGLFKRVISMSGVLFCDWSIAFEPRRRAFKLGQLLGIETENPDELLEY
LQNVPVEKLVNTDPNIITMEELHKNMLKFYHFTPVVEKDFGQEHFLTREP
IEVLKHGNINDVDMLLGFTNEEAIIGITLLEKHLVHLYNKYIDLFAPRLI
TIKATPDKVLEISDRIRHFYFGNKKVNLESMREFVTFVNDCGFIYPIHRF
AGKLSDLINTKVFMYKFSMFSNRNVYGAAGANYKITGASHLEDLMYLFDA
KKFDLKIETTSREYRLINLACTIFTNFAKFGNPTPDTSLGVKWPEYNKET
RKYCDIGDELTIGLDNYRQTVDFWKKVYEDAGLEF


Reference
    Title: The genome of a lepidopteran model insect, the silkworm Bombyx mori
    Xia Q, Wang J, Zhou Z, Li R, Fan W, Cheng D, Cheng T, Qin J, Duana J and Morishita S <88 more author(s)>
    Ref: Insect Biochemistry & Molecular Biology, 38:1036, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer