Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bovin-lipli

Bos taurus; Bos mutus grunniens (Wild yak) (Bos grunniens); Bubalus bubalis (Domestic water buffalo) lipoprotein lipase

Comment
Other strains: Bos taurus; Bos mutus grunniens (Wild yak) (Bos grunniens); Bubalus bubalis (Domestic water buffalo)


Relationship
Family|Lipoprotein_Lipase
Block| L
Position in NCBI Life Tree|Bos taurus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6U7M: Cryo-EM Structure of Helical Lipoprotein Lipase
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: M16966, BOVLPL, AY216661
>3 UniProt links 2 more: P11151, Q866F3, E1ACW2
1 Ncbi-nid : 163304
1 Structure : 6U7M
>3 UniProt links 2 more: Q866F3, P11151, E1ACW2
>3 Interpro links 2 more: Q866F3, P11151, E1ACW2
>3 Prodom links 2 more: Q866F3, P11151, E1ACW2
>3 Pfam links 2 more: Q866F3, P11151, E1ACW2
>3 PIRSF links 2 more: Q866F3, P11151, E1ACW2
>3 SUPERFAM links 2 more: Q866F3, P11151, E1ACW2
Sequence
Graphical view for this peptide sequence: bovin-lipli
Colored MSA for Lipoprotein_Lipase (raw)
MESKALLLLALSVCLQSLTVSRGGLVAADRITGGKDFRDIESKFALRTPE
DTAEDTCHLIPGVTESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVA
ALYKREPDSNVIVVDWLSRAQQHYPVSAGYTKLVGQDVAKFMNWMADEFN
YPLGNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSR
LSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGE
ALRVIAERGLGDVDQLVKCSHERSVHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNMGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKI
HFSGTESNTYTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLLYTEV
DIGELLMLKLKWISDSYFSWSNWWSSPGFDIGKIRVKAGETQKKVIFCSR
EKMSYLQKGKSPVIFVKCHDKSLNRKSG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MESKALLLLALSVCLQSLTVSRGGLVAADRITGGKDFRDIESKFALRTPE
DTAEDTCHLIPGVTESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVA
ALYKREPDSNVIVVDWLSRAQQHYPVSAGYTKLVGQDVAKFMNWMADEFN
YPLGNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSR
LSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGE
ALRVIAERGLGDVDQLVKCSHERSVHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNMGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKI
HFSGTESNTYTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLLYTEV
DIGELLMLKLKWISDSYFSWSNWWSSPGFDIGKIRVKAGETQKKVIFCSR
EKMSYLQKGKSPVIFVKCHDKSLNRKSG


References
15 more
    Title: The structure of helical lipoprotein lipase reveals an unexpected twist in lipase storage
    Gunn KH, Roberts BS, Wang F, Strauss JD, Borgnia MJ, Egelman EH, Neher SB
    Ref: Proc Natl Acad Sci U S A, :, 2020 : PubMed

            

    Title: Structure of bovine milk lipoprotein lipase
    Yang CY, Gu ZW, Yang HX, Rohde MF, Gotto AM, Jr., Pownall HJ
    Ref: Journal of Biological Chemistry, 264:16822, 1989 : PubMed

            

    Title: Molecular cloning and sequence of a cDNA coding for bovine lipoprotein lipase
    Senda M, Oka K, Brown WV, Qasba PK, Furuichi Y
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 84:4369, 1987 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer