Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: culpi-ACHE1

Culex pipiens acetylcholinesterase (Northern house mosquito) Culex quinquefasciatus (Southern house mosquito) (Culex pungens)(ache1 gene)

Comment
This gene is duplicated independently in many strains Labb et al. AJ489456 is mRNA of the strain SLAB and AJ515147 is for the resistant G119S SR strain. genbank accession numbers AJ512688 to AJ512717 are partial sequences of different strain of the Culex pipiens complex (C.pip.pip. and C.pip.quinq) Partial sequence from this gene found in 14 other mosquitos Aedes albopictus (Forest day mosquito) AJ438598 Anopheles albimanus (New world malaria mosquito) AJ438608 Anopheles arabiensis (Mosquito) AJ438603 Anopheles darlingi AJ438599Anopheles funestus AJ438604 Anopheles minimus AJ438601 Anopheles moucheti AJ438602 Anopheles nili AJ438609 Anopheles pseudopunctipennis AJ438605 Anopheles sacharovi AJ438606 Anopheles stephensi (Indo-Pakistan malaria mosquito) AJ438607Anopheles sundaicus AJ438600 and ACES_CULP; Culex pipiens pipiens (Northern house mosquito) NCBI_TaxID 38569 ACES_CULQU Q867X2; Q867X1; Q867X4 Q1WKR8 Culex quinquefasciatus (Southern house mosquito).;ACES_CULTO Q86GC9 Culex torrentium (Mosquito) NCBI_TaxID=42433 Culex pipiens pallens Q5XL61_CULPI acetylcholinesterase (EC 3.1.1.7) by Li et al. 2004 identical except for a 9 aa deletion in N-term In Culex quinquefasciatus Q1WKR8 is for Gongdi-S Q1WKR9 is for Gongdi-R The G119S mutation


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Culex pipiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Culicinae: N E > Culicini: N E > Culex [genus]: N E > Culex [subgenus]: N E > Culex pipiens complex: N E > Culex pipiens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
7 mutations: Table (e.g. : A264T, A328S, A391T ... more)
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 115 more: AJ489456, AJ515147, AJ512688
>3 UniProt links 16 more: Q86GC8, Q867X3, Q867X2
3 Ncbi-nid : 29119621, 22293392, 22293390
3 Ncbi-pid : 29119622, 22293393, 22293391
>3 UniProt links 27 more: Q8MM68, Q86GC8, Q867X3
>3 Interpro links 27 more: Q8MM68, Q86GC8, Q867X3
>3 Prodom links 27 more: Q8MM68, Q86GC8, Q867X3
>3 Pfam links 27 more: Q8MM68, Q86GC8, Q867X3
>3 PIRSF links 27 more: Q8MM68, Q86GC8, Q867X3
>3 SUPERFAM links 27 more: Q8MM68, Q86GC8, Q867X3
Sequence
Graphical view for this peptide sequence: culpi-ACHE1
Colored MSA for ACHE (raw)
MEIRGLITRLLGPCHLRHLILCSLGLYSILVQSVHCRHHDIGSSVAHQLG
SKYSQSSSLSSSSQSSSSLAEEATLNKDSDAFFTPYIGHGDSVRIVDAEL
GTLEREHIHSTTTRRRGLTRRESSSDATDSDPLVITTDKGKIRGTTLEAP
SGKKVDAWMGIPYAQPPLGPLRFRHPRPAERWTGVLNATKPPNSCVQIVD
TVFGDFPGATMWNPNTPLSEDCLYINVVVPRPRPKNAAVMLWIFGGGFYS
GTATLDVYDHRTLASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQ
NLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAI
LQSGSPTAPWALVSREEATLRALRLAEAVNCPHDATKLSDAVECLRTKDP
NELVDNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTDILTGSN
TEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVF
EYTDWIEPDNPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVFMYLY
THRSKGNPWPRWTGVMHGDEINYVFGEPLNSALGYQDDEKDFSRKIMRYW
SNFAKTGNPNPSTPSVDLPEWPKHTAHGRHYLELGLNTTFVGRGPRLRQC
AFWKKYLPQLVAATSNLQVTPAPSVPCESSSTSYRSTLLLIVTLLLVTRF
KI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEIRGLITRLLGPCHLRHLILCSLGLYSILVQSVHCRHHDIGSSVAHQLG
SKYSQSSSLSSSSQSSSSLAEEATLNKDSDAFFTPYIGHGDSVRIVDAEL
GTLEREHIHSTTTRRRGLTRRESSSDATDSDPLVITTDKGKIRGTTLEAP
SGKKVDAWMGIPYAQPPLGPLRFRHPRPAERWTGVLNATKPPNSCVQIVD
TVFGDFPGATMWNPNTPLSEDCLYINVVVPRPRPKNAAVMLWIFGGGFYS
GTATLDVYDHRTLASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQ
NLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAI
LQSGSPTAPWALVSREEATLRALRLAEAVNCPHDATKLSDAVECLRTKDP
NELVDNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTDILTGSN
TEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVF
EYTDWIEPDNPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVFMYLY
THRSKGNPWPRWTGVMHGDEINYVFGEPLNSALGYQDDEKDFSRKIMRYW
SNFAKTGNPNPSTPSVDLPEWPKHTAHGRHYLELGLNTTFVGRGPRLRQC
AFWKKYLPQLVAATSNLQVTPAPSVPCESSSTSYRSTLLLIVTLLLVTRF
KI


References
11 more
    Title: The evolutionary fate of heterogeneous gene duplications: A precarious overdominant equilibrium between environment, sublethality and complementation
    Milesi P, Assogba BS, Atyame CM, Pocquet N, Berthomieu A, Unal S, Makoundou P, Weill M, Labbe P
    Ref: Mol Ecol, 27:493, 2018 : PubMed

            

    Title: Insecticide resistance to organophosphates in Culex pipiens complex from Lebanon
    Osta MA, Rizk ZJ, Labbe P, Weill M, Knio K
    Ref: Parasit Vectors, 5:132, 2012 : PubMed

            

    Title: Independent duplications of the acetylcholinesterase gene conferring insecticide resistance in the mosquito Culex pipiens
    Labbe P, Berthomieu A, Berticat C, Alout H, Raymond M, Lenormand T, Weill M
    Ref: Molecular Biology Evolution, 24:1056, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer