Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: drogr-b4jth3

Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi) GH23353

Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Drosophila grimshawi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Hawaiian Drosophila: N E > picture wing clade: N E > grimshawi clade: N E > grimshawi group: N E > grimshawi subgroup: N E > Drosophila grimshawi: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CH916373
1 UniProt : B4JTH3
1 UniProt : B4JTH3
1 Interpro : B4JTH3
1 Pfam : B4JTH3
1 PIRSF : B4JTH3
1 SUPERFAM : B4JTH3
Sequence
Graphical view for this peptide sequence: drogr-b4jth3
Colored MSA for Neuroligin (raw)
MWECEQMWLMRQLLLSAALIGCLGYAFASTHDVYNGARPGHRIVQTRYGR
LHGMILPLDNFRFLRSVEVFLGVPYATPPIKQNRPTRAPAPWEGIRISDK
YSPVCPQRLPNIQNETAALEKMPKGRLEYLKRLLPFLENQSEDCLYLNIF
SPVNAGANEKKLPVIVFIHGESFEWSSGNPYDGSVLASYGEVVVVTLNYR
LGILGFLNANPSPHAHARVANYGLMDQMAALHWIQQNIQKFGGDPNVVTL
AGHGTGAACINYLMTSPTMVRGLFHRAILMSGSAYSSWALVEDPVLFAIK
LAKEVNCTIPEDLNRHHEQIVDCLRDVPLEDLYNADIQAPNFLTSFGPSV
DGVVIRPGHSNLDIDDLMTRNSKRSSSDAGAQAAGGNGGGSGGFGSAFSG
GAGYFGGAAATTNIGGHYDVLFGVVTGESIWRFSAHDIQNGFEGERRDKI
IRTYVRNAYNYHLNEIFYTIVNEYTDWDRTSQHPINTRDMAVAALSDAQF
VAPIVRTGDILAANSPPPVSSSTPNGGSSSGNAAASTSSGASTQPAGRCY
FYVFDYQTKDGDYPQRMGTVHGEDLPYIFGAPLVDGFSHFPQNYTKSETA
LSEAVMIYWTNFARTGNPNEHHRQDSVLPVSKERNRFRSITWENYDPLHQ
KYLEIGETAKVFPIHFIFFNASHAVVAFVRHNIDF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWECEQMWLMRQLLLSAALIGCLGYAFASTHDVYNGARPGHRIVQTRYGR
LHGMILPLDNFRFLRSVEVFLGVPYATPPIKQNRPTRAPAPWEGIRISDK
YSPVCPQRLPNIQNETAALEKMPKGRLEYLKRLLPFLENQSEDCLYLNIF
SPVNAGANEKKLPVIVFIHGESFEWSSGNPYDGSVLASYGEVVVVTLNYR
LGILGFLNANPSPHAHARVANYGLMDQMAALHWIQQNIQKFGGDPNVVTL
AGHGTGAACINYLMTSPTMVRGLFHRAILMSGSAYSSWALVEDPVLFAIK
LAKEVNCTIPEDLNRHHEQIVDCLRDVPLEDLYNADIQAPNFLTSFGPSV
DGVVIRPGHSNLDIDDLMTRNSKRSSSDAGAQAAGGNGGGSGGFGSAFSG
GAGYFGGAAATTNIGGHYDVLFGVVTGESIWRFSAHDIQNGFEGERRDKI
IRTYVRNAYNYHLNEIFYTIVNEYTDWDRTSQHPINTRDMAVAALSDAQF
VAPIVRTGDILAANSPPPVSSSTPNGGSSSGNAAASTSSGASTQPAGRCY
FYVFDYQTKDGDYPQRMGTVHGEDLPYIFGAPLVDGFSHFPQNYTKSETA
LSEAVMIYWTNFARTGNPNEHHRQDSVLPVSKERNRFRSITWENYDPLHQ
KYLEIGETAKVFPIHFIFFNASHAVVAFVRHNIDF


References
    Title: Assembly reconciliation
    Zimin AV, Smith DR, Sutton G, Yorke JA
    Ref: Bioinformatics, 24:42, 2008 : PubMed

            

    Title: Evolution of genes and genomes on the Drosophila phylogeny
    Clark AG, Eisen MB, Smith DR, Bergman CM, Oliver B, Markow TA, Kaufman TC, Kellis M, Gelbart W and MacCallum I <405 more author(s)>
    Ref: Nature, 450:203, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer