Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-AFMID

Homo sapiens (Human) Kynurenine formamidase

Comment
Catalyzes the hydrolysis of N-formyl-L-kynurenine to L-kynurenine, the second step in the kynurenine pathway of tryptophan degradation. Required for elimination of toxic metabolites


Relationship
Family|Kynurenine-formamidase
Block| H
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : BX648442, BC132824, BC142973
2 UniProt : Q63HM1, A5PLM3
2 UniProt : Q63HM1, A5PLM3
2 Interpro : Q63HM1, A5PLM3
2 Prodom : Q63HM1, A5PLM3
2 Pfam : Q63HM1, A5PLM3
2 PIRSF : Q63HM1, A5PLM3
2 SUPERFAM : Q63HM1, A5PLM3
1 EntrezGene : 125061
1 SNP : 125061
1 UniGene : 558614
1 HUGO HGNC : 20910
1 Ensembl : ENSG00000183077
Sequence
Graphical view for this peptide sequence: human-AFMID
Colored MSA for Kynurenine-formamidase (raw)
MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGI
EATTRARATRKSLLHVPYGDGEGEKVDIYFPDESSEALPFFLFFHGGYWQ
SGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQVTRSVAFVQK
RYPSNKGIYLCGHSAGAHLAAMMLLADWTKHGVTPNLRGFFLVSGVFDLE
PIVYTSQNVALQLTLEDAQRNSPQLKVAQAQPVDPTCRVLVVVGQFDSPE
FHRQSWEFYQTLCQGEWKASFEELHDVDHFEIVENLTQKDNVLTQIILKT
IFQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGI
EATTRARATRKSLLHVPYGDGEGEKVDIYFPDESSEALPFFLFFHGGYWQ
SGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQVTRSVAFVQK
RYPSNKGIYLCGHSAGAHLAAMMLLADWTKHGVTPNLRGFFLVSGVFDLE
PIVYTSQNVALQLTLEDAQRNSPQLKVAQAQPVDPTCRVLVVVGQFDSPE
FHRQSWEFYQTLCQGEWKASFEELHDVDHFEIVENLTQKDNVLTQIILKT
IFQ


References
    Title: The full-ORF clone resource of the German cDNA Consortium
    Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A and Schupp I <9 more author(s)>
    Ref: BMC Genomics, 8:399, 2007 : PubMed

            

    Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)
    Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R and Malek J <104 more author(s)>
    Ref: Genome Res, 14:2121, 2004 : PubMed

            

    Title: Kynurenine formamidase: determination of primary structure and modeling-based prediction of tertiary structure and catalytic triad
    Pabarcus MK, Casida JE
    Ref: Biochimica & Biophysica Acta, 1596:201, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer